Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182479

NGFI-A Binding Protein 1 (EGR1 Binding Protein 1) (NAB1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms nab1, si:dkeyp-84a8.1, NAB1, DKFZp459P0928, K23F3.7, K23F3_7, T5I8.11, T5I8_11
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182479
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NAB1 antibody: synthetic peptide directed towards the N terminal of human NAB1
Sequence ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGIS CSSYERSSNA
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Dog : 91%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against NAB1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name NAB1
Background NAB1 belongs to the NAB family and acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2.
Molecular Weight 54kDa
Gene ID 4664
NCBI Accession NP_005957, NM_005966
UniProt Q13506
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NAB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives for antigen "NGFI-A Binding Protein 1 (EGR1 Binding Protein 1) (NAB1)", type "Antibodies"
Hosts (7), (4)
Reactivities (10), (3), (2), (2), (2), (2), (2), (2), (1)
Applications (10), (3), (2), (2), (1), (1), (1)
Epitopes (2), (2)
Beacon