Did you know that you can buy products from over 140 different suppliers from us?

ALX Homeobox 4 (ALX4) (N-Term) antibody

Details for Product No. ABIN182540
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms lst, FND2, im:7142878, zgc:162606, alx4
Epitope
N-Term
(8), (8), (5), (3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(33), (12), (6), (4), (4), (1)
Host
Rabbit
(27), (11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(37), (11), (10), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182540
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ALX4
Sequence MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAA AAAAAAAQSA
Predicted Reactivity Paramecium tetraurelia :100 %,   Dog :100 %,   Mosquito :100 %,   Kitasatospora setae KM-6054 :100 %,   Bathycoccus sp. RCC1105 virus BpV2 :100 %,   Human :100 %,   Leishmania major :100 %,   Green puffer :100 %,   Slime mold :100 %,   Neurospora crassa :100 %,   Chamek spider monkey :100 %,   Chlorella variabilis :100 %,   Volvox carteri f. nagariensis :100 %,   Blastocystis hominis :100 %,   Rice :100 %,   Mouse :100 %,   Blastopirellula marina DSM 3645 :100 %,   Japanese lamprey :100 %,   Southern house mosquito :100 %,   Fruit fly :100 %,   Castor bean :100 %,   Sorghum :100 %,   Frankia sp. EUN1f :100 %,   Rat :100 %,   Grape :100 %,   Leishmania infantum :90 %,   Wheat :90 %,   Caenorhabditis elegans :90 %,   Perigord truffle :90 %,   Bifidobacterium dentium ATCC 27679 :90 %,   Bifidobacterium dentium JCVIHMP022 :90 %,   Florida lancelet :90 %,   Actinomyces urogenitalis DSM 15434 :90 %,   Tall wheatgrass :90 %,   Aspergillus clavatus :90 %,   Bifidobacterium dentium ATCC 27678 :90 %,   Water opossum :90 %,   Goatgrass :90 %,   Spach goatgrass :90 %,  
Characteristics This is a rabbit polyclonal antibody against ALX4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ALX4
Background ALX4 is a member of the ALX homeobox gene family in humans. The paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members.
Molecular Weight 44 kDa
Gene ID 60529
NCBI Accession NM_021926, NP_068745
UniProt Q9H161
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 411 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ALX Homeobox 4 (ALX4) (N-Term) antibody WB Suggested Anti-ALX4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Mavrogiannis, Antonopoulou, Baxová et al.: "Haploinsufficiency of the human homeobox gene ALX4 causes skull ossification defects." in: Nature genetics, Vol. 27, Issue 1, pp. 17-8, 2001 (PubMed).

Hosts (27), (11)
Reactivities (33), (12), (6), (4), (4), (1)
Applications (37), (11), (10), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (8), (5), (3), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182540
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top