Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182540

ALX Homeobox 4 (ALX4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms lst, FND2, im:7142878, zgc:162606, alx4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182540
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4
Sequence MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAA AAAAAAAQSA
Predicted Reactivity Paramecium tetraurelia :100%,   Dog :100%,   Mosquito :100%,   Kitasatospora setae KM-6054 :100%,   Bathycoccus sp. RCC1105 virus BpV2 :100%,   Human :100%,   Leishmania major :100%,   Green puffer :100%,   Slime mold :100%,   Neurospora crassa :100%,   Chamek spider monkey :100%,   Chlorella variabilis :100%,   Volvox carteri f. nagariensis :100%,   Blastocystis hominis :100%,   Rice :100%,   Mouse :100%,   Blastopirellula marina DSM 3645 :100%,   Japanese lamprey :100%,   Southern house mosquito :100%,   Fruit fly :100%,   Castor bean :100%,   Sorghum :100%,   Frankia sp. EUN1f :100%,   Rat :100%,   Grape :100%,   Leishmania infantum :91%,   Wheat :90%,   Caenorhabditis elegans :90%,   Perigord truffle :90%,   Bifidobacterium dentium ATCC 27679 :90%,   Bifidobacterium dentium JCVIHMP022 :90%,   Florida lancelet :90%,   Actinomyces urogenitalis DSM 15434 :90%,   Tall wheatgrass :90%,   Aspergillus clavatus :90%,   Bifidobacterium dentium ATCC 27678 :90%,   Water opossum :90%,   Goatgrass :90%,   Spach goatgrass :90%,  
Characteristics This is a rabbit polyclonal antibody against ALX4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ALX4
Background ALX4 is a member of the ALX homeobox gene family in humans. The paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members.
Molecular Weight 44kDa
Gene ID 60529
NCBI Accession NP_068745, NM_021926
UniProt Q9H161
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ALX4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mavrogiannis, Antonopoulou, Baxová et al.: "Haploinsufficiency of the human homeobox gene ALX4 causes skull ossification defects." in: Nature genetics, Vol. 27, Issue 1, pp. 17-8, 2001 (PubMed).

Alternatives for antigen "ALX Homeobox 4 (ALX4)", type "Antibodies"
Hosts (18), (11)
Reactivities (24), (10), (5), (4), (4), (1)
Applications (28), (5), (2), (2), (1)
Epitopes (5), (3), (3), (2), (2), (2), (1)
Beacon