Did you know that you can buy products from over 140 different suppliers from us?

Basic Helix-Loop-Helix Family, Member E22 (BHLHE22) (N-Term) antibody

Details for Product No. ABIN182570
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms bhlhb5, MGC145865, BHLHE22, Beta3.1, wu:fq25e11, zgc:64225, BHLHB5, Beta3, CAGL85, TNRC20, Bhlhb5
Epitope
N-Term
(7), (6), (5), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human, Zebrafish (Danio rerio)
(26), (15), (15), (14), (14), (12), (12), (3)
Host
Rabbit
(25), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (10), (7), (7), (6), (4), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182570
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human BHLHB5
Sequence LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCEL VLRAGVADPR
Predicted Reactivity Human, Cow (Bovine), Zebrafish (Danio rerio), Pig (Porcine), Rabbit, Guinea Pig, Rat (Rattus), Mouse (Murine)
Characteristics This is a rabbit polyclonal antibody against BHLHB5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name BHLHB5
Background BHLHB5 is a member of family of basic helix-loop-helix (bHLH) transcription factors. Members of this family have been implicated in many aspects of neural development, including cell growth, differentiation, and cell migration.
Molecular Weight 37 kDa
Gene ID 27319
NCBI Accession NM_152414, NP_689627
UniProt Q8NFJ8
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 381 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Basic Helix-Loop-Helix Family, Member E22 (BHLHE22) (N-Term) antibody anti-Basic Helix-Loop-Helix Family, Member E22 (BHLHE22) (N-Term) antibody
Product cited in: McLellan, Langlands, Kealey: "Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening." in: Mechanisms of development, Vol. 119 Suppl 1, pp. S285-91, 2003 (PubMed).

Validation Images
back to top