Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182587

Nuclear Receptor Co-Repressor 1 (NCOR1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms N-CoR, N-CoR1, TRAC1, hN-CoR, Rxrip13, 5730405M06Rik, A230020K14Rik, RIP13, mKIAA1047, ncor, zgc:56355
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182587
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NCOR1 antibody: synthetic peptide directed towards the N terminal of human NCOR1
Sequence NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAE KTEKKEEEKK
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Guinea pig : 92%, Horse : 92%
Characteristics This is a rabbit polyclonal antibody against NCOR1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name NCOR1
Background NCOR1 mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p.
Molecular Weight 270kDa
Gene ID 9611
UniProt Q60974
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NCOR1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hörlein, Näär, Heinzel et al.: "Ligand-independent repression by the thyroid hormone receptor mediated by a nuclear receptor co-repressor." in: Nature, Vol. 377, Issue 6548, pp. 397-404, 1995 (PubMed).

Alternatives for antigen "Nuclear Receptor Co-Repressor 1 (NCOR1)", type "Antibodies"
Hosts (38), (12), (1)
Reactivities (50), (29), (15)
Applications (41), (25), (21), (13), (10), (5), (4), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon