Did you know that you can buy products from over 140 different suppliers from us?

TAF5-Like RNA Polymerase II, P300/CBP-Associated Factor (PCAF)-Associated Factor, 65kDa (TAF5L) (N-Term) antibody

Details for Product No. ABIN182609
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PAF65B, fi28g02, zgc:63765, wu:fi28g02, 1110005N04Rik, AI849020, taf5l, MGC89568, TAF5L
Epitope
N-Term
(6), (6), (3), (2), (1), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(37), (5), (5), (2), (2), (2), (1), (1)
Host
Rabbit
(28), (9)
Clonality
Polyclonal
Application
Western Blotting (WB)
(34), (16), (2), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182609
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TAF5L
Sequence LTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFY SRFHGMFLQN
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Pig : 90 %, Bovine : 80 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against TAF5L. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TAF5L
Background Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF5L encodes a protein that is a component of the PCAF histone acetylase complex and structurally similar to one of the histone-like TAFs, TAF5. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation.
Molecular Weight 66 kDa
Gene ID 27097
NCBI Accession NM_014409, NP_055224
UniProt O75529
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 589 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TAF5-Like RNA Polymerase II, P300/CBP-Associated Factor (PCAF)-Associated Factor, 65kDa (TAF5L) (N-Term) antibody WB Suggested Anti-TAF5L Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
Background publications Ogryzko, Kotani, Zhang et al.: "Histone-like TAFs within the PCAF histone acetylase complex." in: Cell, Vol. 94, Issue 1, pp. 35-44, 1998 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182609
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top