Nuclear Factor I/A (NFIA) (Middle Region) antibody

Details for Product No. ABIN182644
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CTF, NF-I/A, NF1-A, NFI-A, NFI-L, 1110047K16Rik, 9430022M17Rik, NF1A, si:ch211-88d2.2, wu:fq27e07, zgc:158351, CNFI-A, cNFI-A3, NFIA
Epitope
Middle Region
(4), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(18), (8), (4)
Host
Rabbit
(14), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(16), (5), (3), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN182644
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NFIA
Sequence QHHRPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPA IRYHPQETLK
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against NFIA. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NFIA
Background Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.
Molecular Weight 55 kDa
Gene ID 4774
NCBI Accession NM_005595, NP_005586
UniProt Q8TA97
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Neurogenesis, Chromatin Binding Proteins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 498 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nuclear Factor I/A (NFIA) (Middle Region) antibody WB Suggested Anti-NFIA Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Fazi, Rosa, Fatica et al.: "A minicircuitry comprised of microRNA-223 and transcription factors NFI-A and C/EBPalpha regulates human granulopoiesis." in: Cell, Vol. 123, Issue 5, pp. 819-31, 2005 (PubMed).

Hosts (14), (6)
Reactivities (18), (8), (4)
Applications (16), (5), (3), (2), (2), (1)
Epitopes (4), (2), (2), (1)
back to top