GATA Zinc Finger Domain Containing 2B (GATAD2B) (N-Term) antibody

Details for Product No. ABIN182715
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms MRD18, P66beta, RP11-216N14.6, p68, RGD1308533, AL118180, C430014D17Rik, mKIAA1150, GATAD2B
Epitope
N-Term
(7), (3), (3), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(22), (8), (2), (2), (2), (1)
Host
Rabbit
(16), (8), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(24), (6), (3), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN182715
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GATAD2B
Sequence HELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENI NDEPVDMSAR
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Mouse : 100 %, Pig : 100 %, Dog : 90 %, Rabbit : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against GATAD2B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GATAD2B
Background GATAD2B contains 1GATA-type zinc finger. GATAD2B was identified as potent transcriptional repressors interacting with MBD2 and MBD3. GATAD2B, one of the Mi-2/NuRD complex subunits, mediate MBD2 and histone interaction
Molecular Weight 65 kDa
Gene ID 57459
NCBI Accession NM_020699, NP_065750
UniProt Q8WXI9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 593 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-GATA Zinc Finger Domain Containing 2B (GATAD2B) (N-Term) antibody WB Suggested Anti-GATAD2B Antibody Titration: 0.2-1 ug/ml
Positive Control: 293T cell lysate
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Hosts (16), (8), (2)
Reactivities (22), (8), (2), (2), (2), (1)
Applications (24), (6), (3), (2), (2), (2)
Epitopes (7), (3), (3), (3), (2), (1), (1), (1), (1), (1)
back to top