Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182715

GATA Zinc Finger Domain Containing 2B (GATAD2B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MRD18, P66beta, RP11-216N14.6, p68, RGD1308533, AL118180, C430014D17Rik, mKIAA1150, GATAD2B
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182715
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GATAD2B antibody: synthetic peptide directed towards the N terminal of human GATAD2B
Sequence HELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENI NDEPVDMSAR
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Mouse : 100%, Pig : 100%, Dog : 92%, Rabbit : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against GATAD2B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GATAD2B
Background GATAD2B contains 1GATA-type zinc finger. GATAD2B was identified as potent transcriptional repressors interacting with MBD2 and MBD3. GATAD2B, one of the Mi-2/NuRD complex subunits, mediate MBD2 and histone interaction
Molecular Weight 65kDa
Gene ID 57459
NCBI Accession NP_065750, NM_020699
UniProt Q8WXI9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GATAD2B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "GATA Zinc Finger Domain Containing 2B (GATAD2B)", type "Antibodies"
Hosts (20), (8), (2)
Reactivities (26), (9), (2), (2), (2), (1)
Applications (27), (9), (6), (3), (3), (2)
Epitopes (8), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1)
Beacon