Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182743

Paraneoplastic Antigen MA1 (PNMA1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MA1, 5730402C15Rik, PNMA1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182743
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PNMA1 antibody: synthetic peptide directed towards the middle region of human PNMA1
Sequence KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNP GEKLSAYVIR
Predicted Reactivity Human : 100%, Dog : 85%, Horse : 85%, Mouse : 85%, Pig : 85%, Rat : 85%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against PNMA1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PNMA1
Background PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.
Molecular Weight 40kDa
Gene ID 9240
NCBI Accession NP_006020, NM_006029
UniProt Q8ND90
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PNMA1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dalmau, Gultekin, Voltz et al.: "Ma1, a novel neuron- and testis-specific protein, is recognized by the serum of patients with paraneoplastic neurological disorders." in: Brain : a journal of neurology, Vol. 122 ( Pt 1), pp. 27-39, 1999 (PubMed).

Alternatives for antigen "Paraneoplastic Antigen MA1 (PNMA1)", type "Antibodies"
Hosts (24), (7)
Reactivities (28), (19), (16), (14), (12), (12)
Applications (17), (10), (10), (6), (4), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2)
Beacon