Did you know that you can buy products from over 140 different suppliers from us?

Paraneoplastic Antigen MA1 (PNMA1) (Middle Region) antibody

Details for Product No. ABIN182743
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MA1, 5730402C15Rik, PNMA1
Epitope
Middle Region
(6), (4), (3), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(40), (20), (17), (14), (12), (12)
Host
Rabbit
(30), (13)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(26), (19), (10), (9), (5), (4), (2), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182743
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PNMA1
Sequence KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNP GEKLSAYVIR
Predicted Reactivity Human : 100 %, Dog : 80 %, Horse : 80 %, Mouse : 80 %, Pig : 80 %, Rat : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against PNMA1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PNMA1
Background PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.
Molecular Weight 40 kDa
Gene ID 9240
NCBI Accession NM_006029, NP_006020
UniProt Q8ND90
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 353 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Paraneoplastic Antigen MA1 (PNMA1) (Middle Region) antibody WB Suggested Anti-PNMA1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Dalmau, Gultekin, Voltz et al.: "Ma1, a novel neuron- and testis-specific protein, is recognized by the serum of patients with paraneoplastic neurological disorders." in: Brain : a journal of neurology, Vol. 122 ( Pt 1), pp. 27-39, 1999 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182743
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top