Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182761

ALX Homeobox 4 (ALX4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms lst, FND2, im:7142878, zgc:162606, alx4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182761
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the N terminal of human ALX4
Sequence MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGG DKFGTTFLSA
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against ALX4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ALX4
Background Alx4 is a member of the family of transcription factors that contain the paired-type homeodomain. In contrast to other types of homeodomains, the paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members. Alx4 is co-expressed with Cart1 at several sites during development, including the craniofacial mesenchyme, the mesenchymal derivatives of neural crest cells in the first branchial arch and the limb bud mesenchyme.
Molecular Weight 44kDa
Gene ID 60529
NCBI Accession NP_068745, NM_021926
UniProt Q9H161
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ALX4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wakui, Gregato, Ballif et al.: "Construction of a natural panel of 11p11.2 deletions and further delineation of the critical region involved in Potocki-Shaffer syndrome." in: European journal of human genetics : EJHG, Vol. 13, Issue 5, pp. 528-40, 2005 (PubMed).

Alternatives for antigen "ALX Homeobox 4 (ALX4)", type "Antibodies"
Hosts (18), (11)
Reactivities (24), (10), (5), (4), (3), (1)
Applications (28), (5), (2), (2), (1)
Epitopes (5), (3), (3), (2), (2), (2), (1)
Beacon