Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182771

Short Stature Homeobox 2 (SHOX2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OG12, SHOT, OG12X, Prx3, Og12x, 6330543G17Rik, zgc:65884, zgc:77344, SHOX2, og12, shot, og12x, ogi2x
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Zebrafish (Danio rerio)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182771
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SHOX2 antibody: synthetic peptide directed towards the middle region of human SHOX2
Sequence SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRV APYVNVGALR
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against SHOX2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SHOX2
Background SHOX2 is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients.
Molecular Weight 35kDa
Gene ID 6474
NCBI Accession NP_006875, NM_006884
UniProt O60902
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SHOX2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Blaschke, Monaghan, Schiller et al.: "SHOT, a SHOX-related homeobox gene, is implicated in craniofacial, brain, heart, and limb development." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 95, Issue 5, pp. 2406-11, 1998 (PubMed).

Alternatives for antigen "Short Stature Homeobox 2 (SHOX2)", type "Antibodies"
Hosts (10), (7)
Reactivities (17), (6), (5), (2), (2), (1)
Applications (16), (5), (3), (1), (1), (1)
Epitopes (4), (3), (3), (3), (2), (1)
Beacon