Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182776

Snail Homolog 1 (Drosophila) (SNAI1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
SLUGH2, SNA, SNAH, SNAIL, SNAIL1, dJ710H13.1, Sna, Sna1, Snail, Snail1, AI194338, SNAI1, BG:DS01845.1, CG3956, Dmel\\CG3956, Sco, br28, br29, l(2)35Db, l(2)br28, l(2)br29, l(3)br28, l35Db, sn, Xsnail, ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182776
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SNAI1 antibody: synthetic peptide directed towards the N terminal of human SNAI1
Sequence MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHL LAAIPPPEIL
Predicted Reactivity Human : 100%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against SNAI1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name SNAI1
Background The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo.
Molecular Weight 29kDa
Gene ID 6615
NCBI Accession NP_005976, NM_005985
UniProt O95863
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SNAI1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhou, Deng, Xia et al.: "Dual regulation of Snail by GSK-3beta-mediated phosphorylation in control of epithelial-mesenchymal transition." in: Nature cell biology, Vol. 6, Issue 10, pp. 931-40, 2004 (PubMed).

Alternatives for antigen "Snail Homolog 1 (Drosophila) (SNAI1)", type "Antibodies"
Hosts (60), (13), (7), (1)
Reactivities (80), (41), (19), (2), (2)
Applications (63), (38), (14), (14), (10), (5), (4), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (18), (7), (4), (3), (3), (2), (2), (2), (1), (1)
Beacon