Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182780

SRY (Sex Determining Region Y)-Box 11 (SOX11) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms end1, AI836553, 1110038H03Rik, 6230403H02Rik, XLS13, XLS13b, xSOX-11, xls13a, xsox11, SOX11
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN182780
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SOX11 antibody: synthetic peptide directed towards the N terminal of human SOX11
Sequence MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPD WCKTASGHIK
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 92%, Mouse : 85%, Rat : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against SOX11. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SOX11
Background This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.
Molecular Weight 47kDa
Gene ID 6664
NCBI Accession NP_003099, NM_003108
UniProt P35716
Research Area Neurology, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SOX11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wiebe, Nowling, Rizzino: "Identification of novel domains within Sox-2 and Sox-11 involved in autoinhibition of DNA binding and partnership specificity." in: The Journal of biological chemistry, Vol. 278, Issue 20, pp. 17901-11, 2003 (PubMed).

Branas, Elliott, Richmond et al.: "Alcohol consumption, alcohol outlets, and the risk of being assaulted with a gun." in: Alcoholism, clinical and experimental research, Vol. 33, Issue 5, pp. 906-15, 2009 (PubMed).

Alternatives for antigen "SRY (Sex Determining Region Y)-Box 11 (SOX11)", type "Antibodies"
Hosts (25), (6), (3), (1)
Reactivities (35), (19), (19), (13), (13), (2), (1)
Applications (20), (14), (10), (4), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (6), (3), (2), (1), (1), (1)
Beacon