Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182784

MRG-Binding Protein (MRGBP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms c20orf20, zgc:73167, C20orf20, Eaf7, MRG15BP, URCC4, 1600027N09Rik, AW060503, C80444
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182784
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C20ORF20 antibody: synthetic peptide directed towards the middle region of human C20ORF20
Sequence LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKV MIEEEMKEEM
Predicted Reactivity Horse : 100%, Human : 100%, Bovine : 92%, Dog : 92%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against C20ORF20. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C20ORF20
Background C20orf20 belongs to the EAF7 family. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
Molecular Weight 22kDa
Gene ID 55257
NCBI Accession NP_060740, NM_018270
UniProt Q9NV56
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C20ORF20 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cai, Jin, Tomomori-Sato et al.: "Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex." in: The Journal of biological chemistry, Vol. 278, Issue 44, pp. 42733-6, 2003 (PubMed).

Alternatives for antigen "MRG-Binding Protein (MRGBP)", type "Antibodies"
Hosts (11), (1), (1)
Reactivities (11), (4), (3), (1), (1), (1), (1), (1)
Applications (12), (1), (1), (1), (1), (1)
Epitopes (3), (3), (2), (1), (1), (1)
Beacon