Did you know that you can buy products from over 140 different suppliers from us?

MRG-Binding Protein (MRGBP) (Middle Region) antibody

Details for Product No. ABIN182784
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms c20orf20, zgc:73167, C20orf20, Eaf7, MRG15BP, URCC4, 1600027N09Rik, AW060503, C80444
Epitope
Middle Region
(8), (7), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Human
(17), (3), (3), (1)
Host
Rabbit
(17), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (7), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182784
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C20ORF20
Sequence LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKV MIEEEMKEEM
Predicted Reactivity Horse : 100 %, Human : 100 %, Bovine : 90 %, Dog : 90 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against C20ORF20. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C20ORF20
Background C20orf20 belongs to the EAF7 family. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.
Molecular Weight 22 kDa
Gene ID 55257
NCBI Accession NM_018270, NP_060740
UniProt Q9NV56
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 204 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Cai, Jin, Tomomori-Sato et al.: "Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex." in: The Journal of biological chemistry, Vol. 278, Issue 44, pp. 42733-6, 2003 (PubMed).

Hosts (17), (1), (1)
Reactivities (17), (3), (3), (1)
Applications (18), (7), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (3), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182784
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top