Did you know that you can buy products from over 140 different suppliers from us?

ZFP36 Ring Finger Protein-Like 1 (ZFP36L1) (N-Term) antibody

Details for Product No. ABIN182792
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Berg36, Brf1, ERF1, TIS11b, cMG1, ZFP36L1, berg36, brf1, c3h-2, cmg1, erf-1, erf1, rnf162b, tis11b, BRF1, ERF-1, TIS11B, RNF162B, AW742437, AW743212, D530020L18Rik
Epitope
N-Term
(17), (13), (13), (8), (3), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
(67), (50), (40), (38), (37), (27), (12)
Host
Rabbit
(66), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1)
Application
Western Blotting (WB)
(44), (30), (28), (12), (8), (5), (3), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182792
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZFP36L1
Sequence GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSR FRDRSFSEGG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against ZFP36L1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZFP36L1
Background ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
Molecular Weight 36 kDa
Gene ID 677
NCBI Accession NM_004926, NP_004917
UniProt Q07352
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 338 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ZFP36 Ring Finger Protein-Like 1 (ZFP36L1) (N-Term) antibody WB Suggested Anti-ZFP36L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Blackshear, Phillips, Vazquez-Matias et al.: "Polymorphisms in the genes encoding members of the tristetraprolin family of human tandem CCCH zinc finger proteins." in: Progress in nucleic acid research and molecular biology, Vol. 75, pp. 43-68, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182792
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top