Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182813

Transcription Factor AP-4 (Activating Enhancer Binding Protein 4) (TFAP4) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AP-4, bHLHc41, AI642933, D930048N17Rik, Tcfap4, Tfap4
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182813
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TFAP4 antibody: synthetic peptide directed towards the C terminal of human TFAP4
Sequence EEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSR EEPSGDGELP
Predicted Reactivity Human : 100%, Rat : 92%, Bovine : 85%, Dog : 85%, Mouse : 85%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against TFAP4. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name TFAP4
Background Enhancer binding protein TFAP4 is a transcription factor that activates both viral and cellular genes by binding to the symmetrical DNA sequence, CAGCTG.
Molecular Weight 39kDa
Gene ID 7023
NCBI Accession NP_003214, NM_003223
UniProt Q01664
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TFAP4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Petersenn, Rasch, Heyens et al.: "Structure and regulation of the human growth hormone-releasing hormone receptor gene." in: Molecular endocrinology (Baltimore, Md.), Vol. 12, Issue 2, pp. 233-47, 1998 (PubMed).

Alternatives for antigen "Transcription Factor AP-4 (Activating Enhancer Binding Protein 4) (TFAP4)", type "Antibodies"
Hosts (17), (16)
Reactivities (31), (6), (3), (1)
Applications (28), (15), (10), (8), (6), (6), (3), (1), (1)
Epitopes (6), (6), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon