Transcription Factor AP-4 (Activating Enhancer Binding Protein 4) (TFAP4) (C-Term) antibody

Details for Product No. ABIN182813
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AP-4, bHLHc41, AI642933, D930048N17Rik, Tcfap4, Tfap4
Epitope
C-Term
(6), (5), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(31), (6), (3), (1)
Host
Rabbit
(17), (16)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(28), (13), (9), (7), (6), (6), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182813
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TFAP4
Sequence EEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSR EEPSGDGELP
Predicted Reactivity Human : 100 %, Rat : 90 %, Bovine : 80 %, Dog : 80 %, Mouse : 80 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against TFAP4. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name TFAP4
Background Enhancer binding protein TFAP4 is a transcription factor that activates both viral and cellular genes by binding to the symmetrical DNA sequence, CAGCTG.
Molecular Weight 39 kDa
Gene ID 7023
NCBI Accession NM_003223, NP_003214
UniProt Q01664
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 338 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transcription Factor AP-4 (Activating Enhancer Binding Protein 4) (TFAP4) (C-Term) antibody WB Suggested Anti-TFAP4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
anti-Transcription Factor AP-4 (Activating Enhancer Binding Protein 4) (TFAP4) (C-Term) antibody (2) anti-Transcription Factor AP-4 (Activating Enhancer Binding Protein 4) (TFAP4) (C-Term) antibody (Image 2)
Background publications Petersenn, Rasch, Heyens et al.: "Structure and regulation of the human growth hormone-releasing hormone receptor gene." in: Molecular endocrinology (Baltimore, Md.), Vol. 12, Issue 2, pp. 233-47, 1998 (PubMed).

Hosts (17), (16)
Reactivities (31), (6), (3), (1)
Applications (28), (13), (9), (7), (6), (6), (3), (1), (1)
Epitopes (6), (5), (2), (2), (2), (2), (1), (1), (1), (1)
back to top