Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182826

Ribosomal Protein S16 (RPS16) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms S16, AA420385, AI317031, im:6906552, si:dkey-66d18.1, zgc:153404, CG4046, Dmel\\CG4046, Rp S16, bs32d05.y1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Zebrafish (Danio rerio)
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182826
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RPS16 antibody: synthetic peptide directed towards the N terminal of human RPS16
Sequence SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMI EPRTLQYKLL
Predicted Reactivity African clawed frog : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against RPS16. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name RPS16
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS16 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S9P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight 16kDa
Gene ID 6217
NCBI Accession NP_001011, NM_001020
UniProt P17008
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RPS16 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yoshihama, Uechi, Asakawa et al.: "The human ribosomal protein genes: sequencing and comparative analysis of 73 genes." in: Genome research, Vol. 12, Issue 3, pp. 379-90, 2002 (PubMed).

Alternatives for antigen "Ribosomal Protein S16 (RPS16)", type "Antibodies"
Hosts (21), (1)
Reactivities (23), (3), (3), (1), (1), (1), (1)
Applications (22), (12), (5), (3), (1), (1)
Conjugates (2), (2), (2)
Epitopes (2), (2), (2), (2), (1), (1), (1)
Beacon