Did you know that you can buy products from over 140 different suppliers from us?

Ribosomal Protein S16 (RPS16) (N-Term) antibody

Details for Product No. ABIN182826
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CG4046, Dmel\\CG4046, Rp S16, S16, bs32d05.y1, im:6906552, si:dkey-66d18.1, zgc:153404, AA420385, AI317031
Epitope
N-Term
(5), (4), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Zebrafish (Danio rerio)
(29), (4), (4), (1), (1), (1), (1)
Host
Rabbit
(28), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(29), (19), (10), (4), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182826
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RPS16
Sequence SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMI EPRTLQYKLL
Predicted Reactivity African clawed frog : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against RPS16. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name RPS16
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS16 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S9P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight 16 kDa
Gene ID 6217
NCBI Accession NM_001020, NP_001011
UniProt P17008
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 146 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal Protein S16 (RPS16) (N-Term) antibody WB Suggested Anti-RPS16 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-Ribosomal Protein S16 (RPS16) (N-Term) antibody (2) anti-Ribosomal Protein S16 (RPS16) (N-Term) antibody (Image 2)
anti-Ribosomal Protein S16 (RPS16) (N-Term) antibody (3) Host: Rabbit
Target Name: RPS16
Sample Tissue: Jurkat cell lysatesLane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 2.5 µg/mL Peptide Concentration:..0 µg/mL Lysate Quantity:.41 µg/laneGel Concentration: 12 %
anti-Ribosomal Protein S16 (RPS16) (N-Term) antibody (4) Host: Rabbit
Target Name: RPS16
Sample Tissue: Jurkat
Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 2.5 µg/mL Peptide Concentration:..0 µg/mL Lysate Quantity:.41 µg/laneGel Concentration: 10-20 %
anti-Ribosomal Protein S16 (RPS16) (N-Term) antibody (5) Rabbit Anti-RPS16 Antibody ,Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 µg/mL
Magnification:.00X
Background publications Yoshihama, Uechi, Asakawa et al.: "The human ribosomal protein genes: sequencing and comparative analysis of 73 genes." in: Genome research, Vol. 12, Issue 3, pp. 379-90, 2002 (PubMed).

Validation Images
back to top