Ribosomal Protein S16 (RPS16) (Middle Region) antibody

Details for Product No. ABIN182827
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms S16, AA420385, AI317031, im:6906552, si:dkey-66d18.1, zgc:153404, CG4046, Dmel\\CG4046, Rp S16, bs32d05.y1
Epitope
Middle Region
(2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Zebrafish (Danio rerio)
(21), (4), (4), (1), (1), (1), (1)
Host
Rabbit
(21)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2)
Application
Western Blotting (WB)
(21), (11), (7), (4), (1)
Pubmed 1 reference available
Catalog no. ABIN182827
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RPS16
Sequence LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKK FGGPGARAC
Predicted Reactivity African clawed frog : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against RPS16. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name RPS16
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS16 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S9P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome
Molecular Weight 44 kDa
Gene ID 6217
NCBI Accession NM_001020, NP_001011
UniProt Q8N7E9
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 146 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal Protein S16 (RPS16) (Middle Region) antibody WB Suggested Anti-RPS16 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Background publications Yoshihama, Uechi, Asakawa et al.: "The human ribosomal protein genes: sequencing and comparative analysis of 73 genes." in: Genome research, Vol. 12, Issue 3, pp. 379-90, 2002 (PubMed).

Hosts (21)
Reactivities (21), (4), (4), (1), (1), (1), (1)
Applications (21), (11), (7), (4), (1)
Conjugates (2), (2), (2)
Epitopes (2), (2), (1), (1), (1)
back to top