Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182827

Ribosomal Protein S16 (RPS16) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms S16, AA420385, AI317031, im:6906552, si:dkey-66d18.1, zgc:153404, CG4046, Dmel\\CG4046, Rp S16, bs32d05.y1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Zebrafish (Danio rerio)
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182827
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RPS16 antibody: synthetic peptide directed towards the middle region of human RPS16
Sequence LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKK FGGPGARAC
Predicted Reactivity African clawed frog : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against RPS16. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name RPS16
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS16 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S9P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome
Molecular Weight 44kDa
Gene ID 6217
NCBI Accession NP_001011, NM_001020
UniProt Q8N7E9
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RPS16 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yoshihama, Uechi, Asakawa et al.: "The human ribosomal protein genes: sequencing and comparative analysis of 73 genes." in: Genome research, Vol. 12, Issue 3, pp. 379-90, 2002 (PubMed).

Alternatives for antigen "Ribosomal Protein S16 (RPS16)", type "Antibodies"
Hosts (21), (1)
Reactivities (23), (3), (3), (1), (1), (1), (1)
Applications (22), (12), (6), (3), (1), (1)
Conjugates (2), (2), (2)
Epitopes (2), (2), (2), (2), (1), (1), (1)
Beacon