Zinc Finger Protein 212 (ZNF212) (N-Term) antibody

Details for Product No. ABIN182845
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C2H2-150, ZNF182, ZNFC150, Znf212, mKIAA3011
Epitope
N-Term
(4), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(10), (2), (2)
Host
Rabbit
(9), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182845
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF212
Sequence RSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSL KVLGQTEGEA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against ZNF212. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF212
Background ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution. Like this gene product, a third of the zinc finger proteins containing C2H2 fingers also contain the KRAB domain, which has been found to be involved in protein-protein interactions.
Molecular Weight 55 kDa
Gene ID 7988
NCBI Accession NM_012256, NP_036388
UniProt Q9UDV6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 495 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 212 (ZNF212) (N-Term) antibody WB Suggested Anti-ZNF212 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology...." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Hosts (9), (1)
Reactivities (10), (2), (2)
Applications (10), (1), (1)
Epitopes (4), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top