Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182868

T-Box 4 (TBX4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SPS, 3930401C23, zTbx4, zf-tbx4, TBX4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182868
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TBX4 antibody: synthetic peptide directed towards the middle region of human TBX4
Sequence LRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGT HQALQHYQHE
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Goat : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against TBX4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TBX4
Background The TBX4 gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human homolog of mouse Tbx4, which is closely linked to Tbx2 on mouse chromosome 11. Similarly this gene, like TBX2, maps to human chromosome 17. Expression studies in mouse and chicken show that Tbx4 is expressed in developing hindlimb, but not in forelimb buds, suggesting a role for this gene in regulating limb development and specification of limb identity.
Molecular Weight 60kDa
Gene ID 9496
NCBI Accession NP_060958, NM_018488
UniProt P57082
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TBX4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bongers, Duijf, van Beersum et al.: "Mutations in the human TBX4 gene cause small patella syndrome." in: American journal of human genetics, Vol. 74, Issue 6, pp. 1239-48, 2004 (PubMed).

Alternatives for antigen "T-Box 4 (TBX4)", type "Antibodies"
Hosts (12)
Reactivities (11), (1), (1), (1)
Applications (8), (4), (4), (1)
Epitopes (4), (3), (2), (1), (1), (1)
Beacon