Did you know that you can buy products from over 140 different suppliers from us?

T-Box 4 (TBX4) (Middle Region) antibody

Details for Product No. ABIN182868
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms zTbx4, zf-tbx4, TBX4, SPS, 3930401C23
Epitope
Middle Region
(9), (7), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Dog (Canine), Mouse (Murine), Human
(17), (1), (1)
Host
Rabbit
(17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (10), (4), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182868
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TBX4
Sequence LRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGT HQALQHYQHE
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Goat : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Sheep : 100 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against TBX4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TBX4
Background The TBX4 gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human homolog of mouse Tbx4, which is closely linked to Tbx2 on mouse chromosome 11. Similarly this gene, like TBX2, maps to human chromosome 17. Expression studies in mouse and chicken show that Tbx4 is expressed in developing hindlimb, but not in forelimb buds, suggesting a role for this gene in regulating limb development and specification of limb identity.
Molecular Weight 60 kDa
Gene ID 9496
NCBI Accession NM_018488, NP_060958
UniProt P57082
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 545 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-T-Box 4 (TBX4) (Middle Region) antibody WB Suggested Anti-TBX4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Bongers, Duijf, van Beersum et al.: "Mutations in the human TBX4 gene cause small patella syndrome." in: American journal of human genetics, Vol. 74, Issue 6, pp. 1239-48, 2004 (PubMed).

Validation Images
back to top