Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182885

Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASGPR, ASGPR1, CLEC4H1, HL-1, Asgr, Asgr-1, ASGR, RATRHL1, RHL1, ASGR1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182885
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ASGR1 antibody: synthetic peptide directed towards the N terminal of human ASGR1
Sequence RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSC QMAALQGNGS
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 90%, Bovine : 84%
Characteristics This is a rabbit polyclonal antibody against ASGR1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ASGR1
Background ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
Molecular Weight 33kDa
Gene ID 432
NCBI Accession NP_001662, NM_001671
UniProt Q6FGQ5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ASGR1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Saunier, Triyatni, Ulianich et al.: "Role of the asialoglycoprotein receptor in binding and entry of hepatitis C virus structural proteins in cultured human hepatocytes." in: Journal of virology, Vol. 77, Issue 1, pp. 546-59, 2002 (PubMed).

Alternatives for antigen "Asialoglycoprotein Receptor 1 (ASGR1)", type "Antibodies"
Hosts (29), (7)
Reactivities (34), (24), (19), (17), (17)
Applications (22), (19), (10), (9), (5), (4), (3), (2), (2), (2), (2)
Conjugates (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (1)
Beacon