Did you know that you can buy products from over 140 different suppliers from us?

Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody

Details for Product No. ABIN182885
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASGR1, ASGPR, ASGPR1, CLEC4H1, HL-1, Asgr, Asgr-1, ASGR, RATRHL1, RHL1
Epitope
N-Term
(12), (10), (1), (1), (1)
Reactivity
Dog (Canine), Human
(40), (22), (19), (17), (17)
Host
Rabbit
(38), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(27), (15), (14), (4), (4), (3), (2), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182885
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ASGR1
Sequence RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSC QMAALQGNGS
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against ASGR1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ASGR1
Background ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
Molecular Weight 33 kDa
Gene ID 432
NCBI Accession NM_001671, NP_001662
UniProt Q6FGQ5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 291 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (2) Host: Rabbit
Target Name: ASGR1
Sample Tissue: 293T
Antibody Dilution: 1.0 µg/mL
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (3) Host: Rabbit
Target Name: ASGR1
Sample Tissue: 721_B
Antibody Dilution: 1.0 µg/mL
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (4) Host: Rabbit
Target Name: ASGR1
Sample Tissue: Hela
Antibody Dilution: 1.0 µg/mL
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (5) Host: Rabbit
Target Name: ASGR1
Sample Tissue: HepG2
Antibody Dilution: 1.0 µg/mL ASGR1 is supported by BioGPS gene expression data to be expressed in HepG2
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (6) Host: Rabbit
Target Name: ASGR1
Sample Tissue: Human Adult Placenta
Antibody Dilution: 1.0 µg/mL
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (7) Host: Rabbit
Target Name: ASGR1
Sample Tissue: Human Fetal Heart
Antibody Dilution: 1.0 µg/mL
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (8) Host: Rabbit
Target Name: ASGR1
Sample Tissue: Human Fetal Kidney
Antibody Dilution: 1.0 µg/mL
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (9) Host: Rabbit
Target Name: ASGR1
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0 µg/mL
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (10) Host: Rabbit
Target Name: ASGR1
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0 µg/mL
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (11) Host: Rabbit
Target Name: ASGR1
Sample Tissue: Jurkat
Antibody Dilution: 1.0 µg/mL
anti-Asialoglycoprotein Receptor 1 (ASGR1) (N-Term) antibody (12) Host: Rabbit
Target Name: ASGR1
Sample Tissue: MCF7
Antibody Dilution: 1.0 µg/mL
Background publications Saunier, Triyatni, Ulianich et al.: "Role of the asialoglycoprotein receptor in binding and entry of hepatitis C virus structural proteins in cultured human hepatocytes." in: Journal of virology, Vol. 77, Issue 1, pp. 546-59, 2002 (PubMed).

Validation Images
back to top