Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182897

Kinesin Family Member 5A (KIF5A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NKHC, MY050, SPG10, D12S1889, D10Bwg0738e, Khc, Kif5, Kns, mKIAA4086, KIF5A, kif5a, si:ch211-166e11.4, wu:fj61a10, nkhc, my050, spg10, d12s1889, MGC122802
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182897
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KIF5A antibody: synthetic peptide directed towards the middle region of human KIF5A
Sequence LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVK KALELQMESH
Predicted Reactivity Dog : 100%, Human : 100%, Rabbit : 100%, Horse : 92%, Mouse : 92%, Rat : 92%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against KIF5A. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name KIF5A
Background KIF5A is a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.
Molecular Weight 117kDa
Gene ID 3798
NCBI Accession NP_004975, NM_004984
UniProt Q12840
Research Area Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KIF5A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Reid, Kloos, Ashley-Koch et al.: "A kinesin heavy chain (KIF5A) mutation in hereditary spastic paraplegia (SPG10)." in: American journal of human genetics, Vol. 71, Issue 5, pp. 1189-94, 2002 (PubMed).

Alternatives for antigen "Kinesin Family Member 5A (KIF5A)", type "Antibodies"
Hosts (34), (6)
Reactivities (35), (24), (19), (2)
Applications (32), (28), (18), (6), (4), (4), (1)
Epitopes (8), (4), (4), (2), (2)
Beacon