Kinesin Family Member 3B (KIF3B) (C-Term) antibody

Details for Product No. ABIN182904
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms FLA8, HH0048, KLP-11, AI854312, AW549267, mKIAA0359
Epitope
C-Term
(2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human, Chicken
(5), (2), (1), (1), (1)
Host
Rabbit
(4), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (1), (1)
Pubmed 2 references available
Catalog no. ABIN182904
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KIF3B
Sequence APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSG RKSGSSSSSS
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Bovine : 90 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against KIF3B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KIF3B
Background The protein encoded by the KIF3B gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.
Molecular Weight 85 kDa
Gene ID 142
NCBI Accession NM_004798, NP_004789
UniProt O15066
Research Area Signaling, Cytoskeleton
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 747 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kinesin Family Member 3B (KIF3B) (C-Term) antibody WB Suggested Anti-KIF3B Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Jimbo, Kawasaki, Koyama et al.: "Identification of a link between the tumour suppressor APC and the kinesin superfamily." in: Nature cell biology, Vol. 4, Issue 4, pp. 323-7, 2002 (PubMed).

General Weisschuh, Alavi, Bonin et al.: "Identification of genes that are linked with optineurin expression using a combined RNAi--microarray approach." in: Experimental eye research, Vol. 85, Issue 4, pp. 450-61, 2007 (PubMed).

Hosts (4), (2)
Reactivities (5), (2), (1), (1), (1)
Applications (6), (1), (1)
Epitopes (2), (1), (1)
back to top