Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182904

Kinesin Family Member 3B (KIF3B) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FLA8, HH0048, KLP-11, AI854312, AW549267, mKIAA0359
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN182904
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KIF3B antibody: synthetic peptide directed towards the C terminal of human KIF3B
Sequence APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSG RKSGSSSSSS
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Bovine : 92%, Mouse : 91%, Rat : 91%
Characteristics This is a rabbit polyclonal antibody against KIF3B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KIF3B
Background The protein encoded by the KIF3B gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.
Molecular Weight 85kDa
Gene ID 142
NCBI Accession NP_004789, NM_004798
UniProt O15066
Research Area Signaling, Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KIF3B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jimbo, Kawasaki, Koyama et al.: "Identification of a link between the tumour suppressor APC and the kinesin superfamily." in: Nature cell biology, Vol. 4, Issue 4, pp. 323-7, 2002 (PubMed).

Weisschuh, Alavi, Bonin et al.: "Identification of genes that are linked with optineurin expression using a combined RNAi--microarray approach." in: Experimental eye research, Vol. 85, Issue 4, pp. 450-61, 2007 (PubMed).

Alternatives for antigen "Kinesin Family Member 3B (KIF3B)", type "Antibodies"
Hosts (6), (2)
Reactivities (7), (2), (1), (1), (1)
Applications (8), (1), (1)
Epitopes (3), (2), (2), (1), (1)
Beacon