Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182921

Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tcfl1, si:dkeyp-24a7.1, YL1, CFL1, Swc2, YL-1, TCFL1, CG4621, Dmel\\CG4621, dYL-1, vps72, MGC82727, Vps72, ACYPI009531
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182921
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCFL1 antibody: synthetic peptide directed towards the middle region of human TCFL1
Sequence TEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVT VPLVGEPGPK
Predicted Reactivity Olive baboon :100%,   Mouse :100%,   Sumatran orangutan :100%,   Bovine :100%,   Dog :100%,   Nine-banded armadillo :100%,   Rabbit :100%,   Human :100%,   White-tufted-ear marmoset :100%,   Dusky titi monkey :100%,   Rat :100%,   Small-eared galago :100%,   Zebrafish :92%,   Green puffer :92%,   Atlantic salmon :92%,   African clawed frog :84%,  
Characteristics This is a rabbit polyclonal antibody against TCFL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TCFL1
Background TCFL1 encodes the YL-1 protein which is a subunit of the TRRAP/TIP60 HAT complex, and also is a component of a novel mammalian multiprotein complex that includes the SNF2-related helicase SRCAP.
Molecular Weight 41kDa
Gene ID 6944
NCBI Accession NP_005988, NM_005997
UniProt Q15906
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TCFL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Horikawa, Tanaka, Yuasa et al.: "Molecular cloning of a novel human cDNA on chromosome 1q21 and its mouse homolog encoding a nuclear protein with DNA-binding ability." in: Biochemical and biophysical research communications, Vol. 208, Issue 3, pp. 999-1007, 1995 (PubMed).

Alternatives for antigen "Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72)", type "Antibodies"
Hosts (22), (4)
Reactivities (25), (15), (4), (1), (1), (1), (1), (1)
Applications (26), (13), (7), (3), (3), (1), (1)
Epitopes (4), (4), (3), (1), (1)
Beacon