Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72) (Middle Region) antibody

Details for Product No. ABIN182921
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Tcfl1, si:dkeyp-24a7.1, YL1, CFL1, Swc2, YL-1, TCFL1, CG4621, Dmel\\CG4621, dYL-1, vps72, MGC82727, Vps72, ACYPI009531
Epitope
Middle Region
(4), (3), (3), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
(28), (17), (5), (1), (1), (1), (1), (1)
Host
Rabbit
(25), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(29), (13), (9), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN182921
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TCFL1
Sequence TEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVT VPLVGEPGPK
Predicted Reactivity Olive baboon :100 %,   Mouse :100 %,   Sumatran orangutan :100 %,   Bovine :100 %,   Dog :100 %,   Nine-banded armadillo :100 %,   Rabbit :100 %,   Human :100 %,   White-tufted-ear marmoset :100 %,   Dusky titi monkey :100 %,   Rat :100 %,   Small-eared galago :100 %,   Zebrafish :90 %,   Green puffer :90 %,   Atlantic salmon :90 %,   African clawed frog :80 %,  
Characteristics This is a rabbit polyclonal antibody against TCFL1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TCFL1
Background TCFL1 encodes the YL-1 protein which is a subunit of the TRRAP/TIP60 HAT complex, and also is a component of a novel mammalian multiprotein complex that includes the SNF2-related helicase SRCAP.
Molecular Weight 41 kDa
Gene ID 6944
NCBI Accession NM_005997, NP_005988
UniProt Q15906
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 364 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Horikawa, Tanaka, Yuasa et al.: "Molecular cloning of a novel human cDNA on chromosome 1q21 and its mouse homolog encoding a nuclear protein with DNA-binding ability." in: Biochemical and biophysical research communications, Vol. 208, Issue 3, pp. 999-1007, 1995 (PubMed).

Hosts (25), (4)
Reactivities (28), (17), (5), (1), (1), (1), (1), (1)
Applications (29), (13), (9), (3), (3), (2)
Epitopes (4), (3), (3), (1), (1), (1)
back to top