Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182990

Enolase 1, (Alpha) (ENO1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ENO1L1, MPB1, NNE, PPH, 0610008I15, AL022784, Eno-1, MBP-1, Nne, eno1, wu:fi32b03, wu:fk58e02, zgc:73152, eno1b, eno1l1, mbp-1, mpb1, nne, pph, Pgh1, pENO1, Eno1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182990
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1
Sequence VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIK DYPVVSIEDP
Predicted Reactivity Chicken : 100%, Human : 100%, Pig : 100%, Dog : 92%, Guinea pig : 92%, Mouse : 92%, Rabbit : 92%, Rat : 92%, Zebrafish : 92%, African clawed frog : 85%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against ENO1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name ENO1
Background ENO1 encodes one of three enolase isoenzymes found in mammals, it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome.
Molecular Weight 47kDa
Gene ID 2023
NCBI Accession NP_001419, NM_001428
UniProt Q53HR3
Research Area Cancer, Transcription Factors, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ENO1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lee, Chung, Kim et al.: "Human alpha-enolase from endothelial cells as a target antigen of anti-endothelial cell antibody in Behçet's disease." in: Arthritis and rheumatism, Vol. 48, Issue 7, pp. 2025-35, 2003 (PubMed).

Alternatives for antigen "Enolase 1, (Alpha) (ENO1)", type "Antibodies"
Hosts (57), (28), (3)
Reactivities (80), (28), (21), (13), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Applications (79), (54), (25), (10), (10), (8), (3), (3), (2), (2), (2), (1)
Conjugates (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (6), (4), (3), (2), (2), (1), (1), (1)
Beacon