Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183000

Polycomb Group Ring Finger 3 (PCGF3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DONG1, RNF3, RNF3A, Rnf3, AI662857, E430039C14, 2310035N15Rik, D630042K08Rik, rnf3, dong1, rnf3a, PCGF3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183000
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PCGF3 antibody: synthetic peptide directed towards the middle region of human PCGF3
Sequence FYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNK EAAEEKPEED
Predicted Reactivity Chicken : 100%, Horse : 100%, Human : 100%, Bovine : 92%, Dog : 92%, Mouse : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against PCGF3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PCGF3
Background PCGF3 encodes a protein that contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined.
Molecular Weight 28kDa
Gene ID 10336
NCBI Accession NP_006306, NM_006315
UniProt Q3KNV8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PCGF3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Polycomb Group Ring Finger 3 (PCGF3)", type "Antibodies"
Hosts (16), (7), (4)
Reactivities (26), (14), (14), (13), (13), (12)
Applications (14), (10), (10), (5), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1), (1)
Beacon