Did you know that you can buy products from over 140 different suppliers from us?

RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) (Middle Region) antibody

Details for Product No. ABIN183013
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
RRN3, DKFZp459B073, CG16938, CG3278, CG5951, Dmel\\CG3278, TIF-1A, TIF-IA, Tif-1A, TifIA, dTIF-IA, dyak_GLEANR_13182, DyakGE12956, GE12956, Tif-IA, A-270G1.2, TIFIA, RGD1305001, AL023001, E130302O19Ri ... show more
RRN3, DKFZp459B073, CG16938, CG3278, CG5951, Dmel\\CG3278, TIF-1A, TIF-IA, Tif-1A, TifIA, dTIF-IA, dyak_GLEANR_13182, DyakGE12956, GE12956, Tif-IA, A-270G1.2, TIFIA, RGD1305001, AL023001, E130302O19Rik, R75565, Tif1a show less
Epitope
Middle Region
(8), (7), (6), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Human, Chicken
(32), (3), (3), (3), (2), (2), (1)
Host
Rabbit
(29), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(32), (20), (9), (1), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183013
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RRN3
Sequence VDGKVDNGKTKDLYRDLINIFDKLLLPTHASCHVQFFMFY LCSFKLGFAE
Predicted Reactivity Human : 100 %, Dog : 90 %, Chicken : 90 %, Bovine : 80 %, Guinea pig : 80 %, Horse : 80 %, Mouse : 80 %, Rabbit : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against RRN3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name RRN3
Background In mammals, growth-dependent regulation of RNA polymerase I (Pol I) transcription is mediated by RRN3, an essential initiation factor. It interacts with Pol I in the absence of template DNA, augments Pol I transcription in vivo and rescues transcription in extracts from growth-arrested cells in vitro.
Molecular Weight 74 kDa
Gene ID 54700
NCBI Accession NM_018427, NP_060897
UniProt Q9NYV6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 650 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) (Middle Region) antibody WB Suggested Anti-RRN3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Miller, Panov, Friedrich et al.: "hRRN3 is essential in the SL1-mediated recruitment of RNA Polymerase I to rRNA gene promoters." in: The EMBO journal, Vol. 20, Issue 6, pp. 1373-82, 2001 (PubMed).

Validation Images
back to top