Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183014

Zinc Finger, AN1-Type Domain 6 (ZFAND6) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AWP1, ZA20D3, ZFAND5B, Awp1, Za20d3, 3110005P07Rik, zgc:101121, ZGC:101121, fb11b11, wu:fb11b11, awp1, za20d2, za20d3, zfand5b, MGC75964
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN183014
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZA20D3 antibody: synthetic peptide directed towards the middle region of human ZA20D3
Sequence SDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECR CGNVYCGVHR
Predicted Reactivity Dog :100%,   Bovine :100%,   Sumatran orangutan :100%,   Rat :100%,   Mouse :100%,   Human :100%,   Chicken :85%,  
Characteristics This is a rabbit polyclonal antibody against ZA20D3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name ZA20D3
Background ZA20D3 is a zinc-finger protein located on chromosome 15.
Molecular Weight 23kDa
Gene ID 54469
NCBI Accession NP_061879, NM_019006
UniProt Q6FIF0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZA20D3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Duan, Sun, Li et al.: "Cloning and characterization of AWP1, a novel protein that associates with serine/threonine kinase PRK1 in vivo." in: Gene, Vol. 256, Issue 1-2, pp. 113-21, 2000 (PubMed).

Background publications Branlant, Flesch, Branlant: "Molecular cloning of the glyceraldehyde-3-phosphate dehydrogenase genes of Bacillus stearothermophilus and Escherichia coli, and their expression in Escherichia coli." in: Gene, Vol. 25, Issue 1, pp. 1-7, 1984 (PubMed).

Alternatives for antigen "Zinc Finger, AN1-Type Domain 6 (ZFAND6)", type "Antibodies"
Hosts (16)
Reactivities (16), (14), (14), (14), (14), (2), (1), (1), (1)
Applications (10), (7), (5), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2)
Beacon