Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183016

Tripartite Motif Containing 41 (TRIM41) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RINCK, AW552703, BC020156, R75223, TRIM41
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183016
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIM41 antibody: synthetic peptide directed towards the C terminal of human TRIM41
Sequence AQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAH VHTFSAAFLG
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against TRIM41. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name TRIM41
Background The TRIM41 gene encodes a protein observed in the cytoplasm and the nucleus. Nuclear transport is mediated by an N-terminal segment common to both alpha and beta isoforms, but independent of a classical nuclear localization signal sequence.
Molecular Weight 72kDa
Gene ID 90933
NCBI Accession NP_291027, NM_033549
UniProt Q8WV44
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIM41 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kobayashi, Hanai: "M phase-specific association of human topoisomerase IIIbeta with chromosomes." in: Biochemical and biophysical research communications, Vol. 287, Issue 1, pp. 282-7, 2001 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 41 (TRIM41)", type "Antibodies"
Hosts (28)
Reactivities (28), (22), (19), (15), (15), (1), (1), (1)
Applications (19), (10), (8), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (2), (1), (1), (1), (1)
Beacon