Tripartite Motif Containing 41 (TRIM41) (C-Term) antibody

Details for Product No. ABIN183016
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RINCK, AW552703, BC020156, R75223, TRIM41
Epitope
C-Term
(4), (4), (1), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(28), (19), (19), (14), (14), (1), (1), (1)
Host
Rabbit
(27), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(19), (10), (5), (4), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183016
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TRIM41
Sequence AQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAH VHTFSAAFLG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against TRIM41. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name TRIM41
Background The TRIM41 gene encodes a protein observed in the cytoplasm and the nucleus. Nuclear transport is mediated by an N-terminal segment common to both alpha and beta isoforms, but independent of a classical nuclear localization signal sequence.
Molecular Weight 72 kDa
Gene ID 90933
NCBI Accession NM_033549, NP_291027
UniProt Q8WV44
Research Area Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 630 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 41 (TRIM41) (C-Term) antibody anti-Tripartite Motif Containing 41 (TRIM41) (C-Term) antibody
Background publications Kobayashi, Hanai: "M phase-specific association of human topoisomerase IIIbeta with chromosomes." in: Biochemical and biophysical research communications, Vol. 287, Issue 1, pp. 282-7, 2001 (PubMed).

Hosts (27), (1)
Reactivities (28), (19), (19), (14), (14), (1), (1), (1)
Applications (19), (10), (5), (4), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (4), (1), (1), (1), (1)
back to top