Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183037

Suppressor of Variegation 4-20 Homolog 1 (Drosophila) (SUV420H1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CGI85, KMT5B, AA117471, C630029K18Rik, Suv4-20h1, CGI-85, cgi-85, cgi85, kmt5b, suv420h1, SUV420H1, wu:fb97g06, wu:fi57g03, zgc:103527
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183037
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SUV420H1 antibody: synthetic peptide directed towards the C terminal of human SUV420H1
Sequence NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCC SDPLSLLESR
Predicted Reactivity Human : 100%, Horse : 92%, Rat : 90%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against SUV420H1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SUV420H1
Background SUV420H1 is a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined.
Molecular Weight 52kDa
Gene ID 51111
NCBI Accession AAH98121, NM_016028
UniProt Q4V775
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SUV420H1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Suppressor of Variegation 4-20 Homolog 1 (Drosophila) (SUV420H1)", type "Antibodies"
Hosts (14)
Reactivities (13), (3), (1), (1), (1), (1), (1)
Applications (14), (4), (3), (3), (1), (1)
Epitopes (7), (3), (2), (2), (2), (1), (1), (1)
Beacon