Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183048

Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Nac1, Btbd14b, 2010001H03Rik, 4930511N13Rik, BEND8, BTBD14B, BTBD30, NAC-1, NAC1, Nac-1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183048
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the middle region of human BTBD14B
Sequence EGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPES RNRIRVRQDL
Predicted Reactivity Bovine :100%,   Rat :100%,   Mouse :100%,   Human :100%,   Dog :81%,  
Characteristics This is a rabbit polyclonal antibody against BTBD14B. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name BTBD14B
Background The function of the Anti-BTBD14B gene has not yet been determined
Molecular Weight 57kDa
Gene ID 112939
NCBI Accession NP_443108, NM_052876
UniProt Q96RE7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-BTBD14B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1)", type "Antibodies"
Hosts (25), (19), (6)
Reactivities (46), (17), (16), (16), (14), (12)
Applications (36), (17), (15), (13), (12), (10), (9), (7), (1)
Conjugates (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (2), (1)
Beacon