Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (Middle Region) antibody

Details for Product No. ABIN183048
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Nac1, Btbd14b, 2010001H03Rik, 4930511N13Rik, BEND8, BTBD14B, BTBD30, NAC-1, NAC1, Nac-1
Epitope
Middle Region
(5), (3), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(38), (16), (16), (16), (14), (12)
Host
Rabbit
(22), (15), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(31), (12), (11), (10), (10), (8), (7), (7), (1)
Pubmed 1 reference available
Catalog no. ABIN183048
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human BTBD14B
Sequence EGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPES RNRIRVRQDL
Predicted Reactivity Bovine :100 %,   Rat :100 %,   Mouse :100 %,   Human :100 %,   Dog :80 %,  
Characteristics This is a rabbit polyclonal antibody against BTBD14B. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name BTBD14B
Background The function of the Anti-BTBD14B gene has not yet been determined
Molecular Weight 57 kDa
Gene ID 112939
NCBI Accession NM_052876, NP_443108
UniProt Q96RE7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 527 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (Middle Region) antibody WB Suggested Anti-BTBD14B Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (Middle Region) antibody (2) anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (Middle Region) antibody (Image 2)
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (22), (15), (5)
Reactivities (38), (16), (16), (16), (14), (12)
Applications (31), (12), (11), (10), (10), (8), (7), (7), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (2), (1)
back to top