Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183049

Kelch-Like 36 (Drosophila) (KLHL36) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C16orf44, C18H16orf44, zgc:110268
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183049
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C16ORF44 antibody: synthetic peptide directed towards the N terminal of human C16ORF44
Sequence FCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDGFILN HFGTLSFTPD
Predicted Reactivity Bovine :100%,   Dog :100%,   Mouse :100%,   Rat :100%,   Human :100%,   Green puffer :78%,   Zebrafish :78%,   Clostridium botulinum C str. Eklund :76%,  
Characteristics This is a rabbit polyclonal antibody against C16ORF44. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name C16ORF44
Background C16orf44 is an open reading frame 44, found in chromosome 16
Molecular Weight 70kDa
Gene ID 79786
NCBI Accession NP_079007, NM_024731
UniProt Q8N4N3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C16ORF44 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Kelch-Like 36 (Drosophila) (KLHL36)", type "Antibodies"
Hosts (21), (1)
Reactivities (22), (13), (13), (13), (12)
Applications (10), (10), (7), (6), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1), (1), (1), (1)
Beacon