Did you know that you can buy products from over 140 different suppliers from us?

Kelch-Like 13 (Drosophila) (KLHL13) (N-Term) antibody

Details for Product No. ABIN183060
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1200009K10Rik, AI451128, Bklhd2, D130072F20Rik, mKIAA1309, BKLHD2
Epitope
N-Term
(1), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Cow (Bovine), Human
(23), (13), (13), (11), (11), (11), (11)
Host
Rabbit
(17), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(14), (9), (7), (7), (5), (4), (4), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183060
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KLHL13
Sequence KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKL SLGGSEMGLS
Predicted Reactivity Horse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against KLHL13. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name KLHL13
Background KLHL13 contains 6 Kelch repeats and 1 BTB (POZ) domain. The function of this protein remains unknown
Molecular Weight 74 kDa
Gene ID 90293
NCBI Accession NM_033495, NP_277030
UniProt Q9P2N7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 655 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kelch-Like 13 (Drosophila) (KLHL13) (N-Term) antibody WB Suggested Anti-KLHL13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
anti-Kelch-Like 13 (Drosophila) (KLHL13) (N-Term) antibody (2) anti-Kelch-Like 13 (Drosophila) (KLHL13) (N-Term) antibody (Image 2)
anti-Kelch-Like 13 (Drosophila) (KLHL13) (N-Term) antibody (3) WB Suggested Anti-KLHL13
Antibody Titration: 0.2-1 µg/mL ELISA Titer: 1:.2500
Positive Control: Jurkat cell lysate
Product cited in: Nagase, Kikuno, Ishikawa et al.: "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 7, Issue 1, pp. 65-73, 2000 (PubMed).

Validation Images
back to top