Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183060

Kelch-Like 13 (Drosophila) (KLHL13) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BKLHD2, 1200009K10Rik, AI451128, Bklhd2, D130072F20Rik, mKIAA1309
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183060
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KLHL13 antibody: synthetic peptide directed towards the N terminal of human KLHL13
Sequence KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKL SLGGSEMGLS
Predicted Reactivity Horse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against KLHL13. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name KLHL13
Background KLHL13 contains 6 Kelch repeats and 1 BTB (POZ) domain. The function of this protein remains unknown
Molecular Weight 74kDa
Gene ID 90293
NCBI Accession NP_277030, NM_033495
UniProt Q9P2N7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KLHL13 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Nagase, Kikuno, Ishikawa et al.: "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 7, Issue 1, pp. 65-73, 2000 (PubMed).

Alternatives for antigen "Kelch-Like 13 (Drosophila) (KLHL13)", type "Antibodies"
Hosts (17), (5)
Reactivities (21), (13), (13), (12), (11), (11), (11)
Applications (12), (9), (8), (6), (3), (3), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon