Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183081

Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310065A22Rik, AI426270, AW214556, D130071B19Rik, Nirf, NIRF, RNF107, URF2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN183081
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UHRF2 antibody: synthetic peptide directed towards the N terminal of human UHRF2
Sequence TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMN VKDLRPRART
Predicted Reactivity Human : 100%, Rabbit : 100%, Guinea pig : 92%, Rat : 92%, Bovine : 85%, Dog : 85%, Horse : 85%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against UHRF2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name UHRF2
Background UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
Molecular Weight 90kDa
Gene ID 115426
NCBI Accession NP_690856, NM_152896
UniProt Q96PU4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UHRF2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Liu, Zhu, Zhou et al.: "[Analysis of diagnosis and misdiagnosis of pulmonary thromboembolism in emergency]." in: Zhongguo wei zhong bing ji jiu yi xue = Chinese critical care medicine = Zhongguo weizhongbing jijiuyixue, Vol. 16, Issue 8, pp. 464-7, 2004 (PubMed).

Background publications Li, Mori, Hata et al.: "NIRF induces G1 arrest and associates with Cdk2." in: Biochemical and biophysical research communications, Vol. 319, Issue 2, pp. 464-8, 2004 (PubMed).

Alternatives for antigen "Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2)", type "Antibodies"
Hosts (23), (7)
Reactivities (28), (15), (13), (13), (12), (1), (1), (1), (1)
Applications (20), (9), (7), (6), (5), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1), (1), (1)
Beacon