Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (N-Term) antibody

Details for Product No. ABIN183081
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2310065A22Rik, AI426270, AW214556, D130071B19Rik, Nirf, NIRF, RNF107, URF2
Epitope
N-Term
(2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(30), (15), (14), (13), (12), (1), (1), (1), (1)
Host
Rabbit
(24), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(21), (9), (7), (6), (6), (2), (1), (1), (1)
Pubmed 2 references available
Catalog no. ABIN183081
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human UHRF2
Sequence TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMN VKDLRPRART
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Guinea pig : 90 %, Rat : 90 %, Bovine : 80 %, Dog : 80 %, Horse : 80 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against UHRF2. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name UHRF2
Background UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
Molecular Weight 90 kDa
Gene ID 115426
NCBI Accession NM_152896, NP_690856
UniProt Q96PU4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 802 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (N-Term) antibody WB Suggested Anti-UHRF2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
anti-Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (N-Term) antibody (2) anti-Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (N-Term) antibody (Image 2)
Product cited in: Liu, Zhu, Zhou et al.: "[Analysis of diagnosis and misdiagnosis of pulmonary thromboembolism in emergency]." in: Zhongguo wei zhong bing ji jiu yi xue = Chinese critical care medicine = Zhongguo weizhongbing jijiuyixue, Vol. 16, Issue 8, pp. 464-7, 2004 (PubMed).

Background publications Li, Mori, Hata et al.: "NIRF induces G1 arrest and associates with Cdk2." in: Biochemical and biophysical research communications, Vol. 319, Issue 2, pp. 464-8, 2004 (PubMed).

Hosts (24), (7)
Reactivities (30), (15), (14), (13), (12), (1), (1), (1), (1)
Applications (21), (9), (7), (6), (6), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1), (1), (1), (1)
back to top