Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183086

Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tcf1, TCF-1, AI465550
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183086
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the N terminal of human TCF7
Sequence PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQ KQVHRPLQTP
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Dog : 92%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against TCF7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TCF7
Background The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.
Molecular Weight 30kDa
Gene ID 6932
NCBI Accession NP_963963, NM_201632
UniProt P36402-2
Research Area Stem Cells, Transcription Factors, Wnt Signaling, Wnt
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TCF7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Smit, Baas, Kuipers et al.: "Wnt activates the Tak1/Nemo-like kinase pathway." in: The Journal of biological chemistry, Vol. 279, Issue 17, pp. 17232-40, 2004 (PubMed).

Alternatives for antigen "Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7)", type "Antibodies"
Hosts (24), (8), (2)
Reactivities (34), (10), (2), (1), (1)
Applications (32), (16), (5), (4), (3), (2), (2), (1), (1), (1)
Epitopes (6), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon