Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183087

Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tcf1, TCF-1, AI465550
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183087
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7
Sequence PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKP TIKKPLNAFM
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Dog : 92%, Mouse : 92%, Pig : 92%, Rat : 92%, Bovine : 85%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against TCF7. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name TCF7
Background The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.
Molecular Weight 42kDa
Gene ID 6932
NCBI Accession NP_003193, NM_003202
UniProt Q86WR9
Research Area Stem Cells, Transcription Factors, Wnt Signaling, Wnt
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TCF7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Smit, Baas, Kuipers et al.: "Wnt activates the Tak1/Nemo-like kinase pathway." in: The Journal of biological chemistry, Vol. 279, Issue 17, pp. 17232-40, 2004 (PubMed).

Alternatives for antigen "Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7)", type "Antibodies"
Hosts (24), (8), (2)
Reactivities (34), (10), (2), (1), (1)
Applications (32), (16), (5), (4), (3), (2), (1), (1), (1), (1)
Epitopes (7), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon