Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (Middle Region) antibody

Details for Product No. ABIN183087
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tcf1, TCF-1, AI465550
Epitope
Middle Region
(13), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(45), (11), (2), (2), (1)
Host
Rabbit
(35), (8), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(43), (21), (5), (4), (3), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183087
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TCF7
Sequence PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKP TIKKPLNAFM
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Dog : 90 %, Mouse : 90 %, Pig : 90 %, Rat : 90 %, Bovine : 80 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against TCF7. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name TCF7
Background The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.
Molecular Weight 42 kDa
Gene ID 6932
NCBI Accession NM_003202, NP_003193
UniProt Q86WR9
Research Area Stem Cells, Wnt, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 384 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (Middle Region) antibody anti-Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) (Middle Region) antibody
Background publications Smit, Baas, Kuipers et al.: "Wnt activates the Tak1/Nemo-like kinase pathway." in: The Journal of biological chemistry, Vol. 279, Issue 17, pp. 17232-40, 2004 (PubMed).

Hosts (35), (8), (2)
Reactivities (45), (11), (2), (2), (1)
Applications (43), (21), (5), (4), (3), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (13), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top