Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183100

Tripartite Motif Containing 9 (TRIM9) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI835002, mKIAA0282, C030048G07Rik, RNF91, SPRING, fj48c11, zgc:77357, wu:fj48c11, TRIM9, Asap, CG13145, CG31721, CG6256, Dmel\\CG31721, asap
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183100
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIM9 antibody: synthetic peptide directed towards the C terminal of human TRIM9
Sequence DGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEGKALQQ YPSERELRGI
Predicted Reactivity Human : 100%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against TRIM9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRIM9
Background The protein encoded by TRIM9 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified.
Molecular Weight 61kDa
Gene ID 114088
NCBI Accession NP_443210, NM_052978
UniProt Q9C026-5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIM9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Reymond, Meroni, Fantozzi et al.: "The tripartite motif family identifies cell compartments." in: The EMBO journal, Vol. 20, Issue 9, pp. 2140-51, 2001 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 9 (TRIM9)", type "Antibodies"
Hosts (19), (11)
Reactivities (29), (8), (7), (5), (4), (2)
Applications (29), (10), (8), (5), (3), (2), (1)
Epitopes (12), (8), (2), (2), (2), (1), (1), (1), (1)
Beacon