Potassium Channel Tetramerisation Domain Containing 10 (KCTD10) (N-Term) antibody

Details for Product No. ABIN183165
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms BTBD28, ULRO61, hBACURD3, AW536343, C87062, mBACURD3, zgc:63846, wu:fb30g12, kctd10, KCTD10
Epitope
N-Term
(1), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
(5), (1), (1), (1), (1), (1)
Host
Rabbit
(6), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183165
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KCTD10
Sequence MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGG ALYYTTMQTL
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Guinea pig : 90 %, Mouse : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against KCTD10. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name KCTD10
Background KCTD10, a rat potassium channel tetramerisation domain-containing 10 gene is a novel member of the polymerase delta-interacting protein 1 (PDIP1) gene family. KCTD10 shares significant similarity in amino acid sequence to PDIP1 and can interact with the small subunit of DNA polymerase delta and PCNA as PDIP1 does. Like PDIP1, the expression of KCTD10 gene can be induced by TNF-alpha in NIH3T3 cells.
Molecular Weight 34 kDa
Gene ID 83892
NCBI Accession NM_031954, NP_114160
UniProt Q9H3F6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 313 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Potassium Channel Tetramerisation Domain Containing 10 (KCTD10) (N-Term) antibody WB Suggested Anti-KCTD10 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (6), (1)
Reactivities (5), (1), (1), (1), (1), (1)
Applications (7), (1), (1), (1)
Epitopes (1), (1), (1), (1)
back to top