Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183165

Potassium Channel Tetramerisation Domain Containing 10 (KCTD10) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTBD28, ULRO61, hBACURD3, AW536343, C87062, mBACURD3, zgc:63846, wu:fb30g12, kctd10, KCTD10
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183165
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCTD10 antibody: synthetic peptide directed towards the N terminal of human KCTD10
Sequence MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGG ALYYTTMQTL
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Guinea pig : 92%, Mouse : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against KCTD10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name KCTD10
Background KCTD10, a rat potassium channel tetramerisation domain-containing 10 gene is a novel member of the polymerase delta-interacting protein 1 (PDIP1) gene family. KCTD10 shares significant similarity in amino acid sequence to PDIP1 and can interact with the small subunit of DNA polymerase delta and PCNA as PDIP1 does. Like PDIP1, the expression of KCTD10 gene can be induced by TNF-alpha in NIH3T3 cells.
Molecular Weight 34kDa
Gene ID 83892
NCBI Accession NP_114160, NM_031954
UniProt Q9H3F6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCTD10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Potassium Channel Tetramerisation Domain Containing 10 (KCTD10)", type "Antibodies"
Hosts (8)
Reactivities (6), (1), (1), (1), (1), (1)
Applications (8), (3), (3), (1)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon