Did you know that you can buy products from over 140 different suppliers from us?

Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9) (C-Term) antibody

Details for Product No. ABIN183192
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NUDT10, AI462474, 1190002C07Rik, sb:cb392, wu:fj16b09, wu:fu33g07, zgc:63924, LOC100230616
Epitope
C-Term
(8), (8), (4), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(20), (11), (4), (2), (2)
Host
Rabbit
(20), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(28), (11), (8), (4), (2), (2), (2), (1), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183192
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human NUDT9
Sequence LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHW SEDSEADCHA
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 80 %, Guinea pig : 80 %, Sheep : 80 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against NUDT9. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name NUDT9
Background Human ADP-ribose pyrophosphatase NUDT9 belongs to a superfamily of Nudix hydrolases that catabolize potentially toxic compounds in the cell. NUDT9 alpha protein is targeted highly specifically to mitochondria, whereas the predicted protein of the NUDT9 beta transcript, which is missing this sequence, exhibits no clear subcellular localization. Investigation of the physical and enzymatic properties of NUDT9 indicates that it is functional as a monomer, optimally active at near neutral pH, and that it requires divalent metal ions and an intact Nudix motif for enzymatic activity.
Molecular Weight 33 kDa
Gene ID 53343
NCBI Accession NM_198038, NP_932155
UniProt Q8NG26
Research Area Signaling, Metabolism, Enzymes
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 300 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9) (C-Term) antibody WB Suggested Anti-NUDT9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9) (C-Term) antibody (2) anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9) (C-Term) antibody (Image 2)
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

General Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Hosts (20), (9)
Reactivities (20), (11), (4), (2), (2)
Applications (28), (11), (8), (4), (2), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (8), (4), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183192
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top