Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183192

Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NUDT10, AI462474, 1190002C07Rik, sb:cb392, wu:fj16b09, wu:fu33g07, zgc:63924, LOC100230616
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN183192
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the C terminal of human NUDT9
Sequence LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHW SEDSEADCHA
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Bovine : 85%, Guinea pig : 85%, Sheep : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against NUDT9. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name NUDT9
Background Human ADP-ribose pyrophosphatase NUDT9 belongs to a superfamily of Nudix hydrolases that catabolize potentially toxic compounds in the cell. NUDT9 alpha protein is targeted highly specifically to mitochondria, whereas the predicted protein of the NUDT9 beta transcript, which is missing this sequence, exhibits no clear subcellular localization. Investigation of the physical and enzymatic properties of NUDT9 indicates that it is functional as a monomer, optimally active at near neutral pH, and that it requires divalent metal ions and an intact Nudix motif for enzymatic activity.
Molecular Weight 33kDa
Gene ID 53343
NCBI Accession NP_932155, NM_198038
UniProt Q8NG26
Research Area Signaling, Metabolism, Enzymes
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NUDT9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Alternatives for antigen "Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9)", type "Antibodies"
Hosts (16), (9)
Reactivities (20), (8), (4), (2), (2)
Applications (23), (6), (5), (4), (2), (2), (2), (2), (1)
Epitopes (5), (4), (2), (2), (2), (1)
Beacon