Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183222

Zinc Finger Protein 239 (ZNF239) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HOK-2, MOK2, Mok-2, Mok2, Znf239, ZNF239, DKFZp468C049
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183222
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF239 antibody: synthetic peptide directed towards the N terminal of human ZNF239
Sequence SRNRDSVMTLQSGCFENIESETYLPLKVSSQIDTQDSSVK FCKNEPQDHQ
Predicted Reactivity Sumatran orangutan :100%,   Human :100%,   Crab-eating macaque :92%,  
Characteristics This is a rabbit polyclonal antibody against ZNF239. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF239
Background MOK2 proteins are DNA- and RNA-binding proteins that are mainly associated with nuclear RNP components, including the nucleoli and extranucleolar structures (Arranz et al., 1997 [PubMed 9121460]).
Molecular Weight 52kDa
Gene ID 8187
NCBI Accession NP_005665, NM_005674
UniProt Q16600
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF239 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dreuillet, Tillit, Kress et al.: "In vivo and in vitro interaction between human transcription factor MOK2 and nuclear lamin A/C." in: Nucleic acids research, Vol. 30, Issue 21, pp. 4634-42, 2002 (PubMed).

Alternatives for antigen "Zinc Finger Protein 239 (ZNF239)", type "Antibodies"
Hosts (20), (3)
Reactivities (23), (12), (12), (12), (12)
Applications (14), (10), (6), (5), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (1), (1), (1), (1)
Beacon