Retinoid X Receptor, gamma (RXRG) (N-Term) antibody

Details for Product No. ABIN183229
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RXRC, NR2B3, RXRgamma, RXR-gamma, nr2b3, xrxrg, Nr2b3, zgc:92183, RXRG, rxrc, rxr, rxra, rxrg, etID309731.5
Epitope
N-Term
(11), (5), (2), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
(55), (32), (23), (15), (15), (14), (2), (1)
Host
Rabbit
(43), (12), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(42), (22), (17), (10), (9), (7), (4), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183229
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RXRG
Sequence GSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSV SSSEDIKPLP
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 90 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against RXRG. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name RXRG
Background RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Weight 51 kDa
Gene ID 6258
NCBI Accession NM_006917, NP_008848
UniProt P48443
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 463 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Retinoid X Receptor, gamma (RXRG) (N-Term) antibody WB Suggested Anti-RXRG Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Klopper, Hays, Sharma et al.: "Retinoid X receptor-gamma and peroxisome proliferator-activated receptor-gamma expression predicts thyroid carcinoma cell response to retinoid and thiazolidinedione treatment." in: Molecular cancer therapeutics, Vol. 3, Issue 8, pp. 1011-20, 2004 (PubMed).

Hosts (43), (12), (5)
Reactivities (55), (32), (23), (15), (15), (14), (2), (1)
Applications (42), (22), (17), (10), (9), (7), (4), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (5), (2), (2), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top