Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183229

Retinoid X Receptor, gamma (RXRG) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RXRC, NR2B3, RXRgamma, RXR-gamma, nr2b3, xrxrg, Nr2b3, zgc:92183, RXRG, rxrc, rxr, rxra, rxrg, etID309731.5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183229
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG
Sequence GSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSV SSSEDIKPLP
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Guinea pig : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against RXRG. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name RXRG
Background RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Weight 51kDa
Gene ID 6258
NCBI Accession NP_008848, NM_006917
UniProt P48443
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RXRG antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Klopper, Hays, Sharma et al.: "Retinoid X receptor-gamma and peroxisome proliferator-activated receptor-gamma expression predicts thyroid carcinoma cell response to retinoid and thiazolidinedione treatment." in: Molecular cancer therapeutics, Vol. 3, Issue 8, pp. 1011-20, 2004 (PubMed).

Alternatives for antigen "Retinoid X Receptor, gamma (RXRG)", type "Antibodies"
Hosts (44), (13), (6)
Reactivities (56), (35), (25), (17), (15), (15), (2), (1), (1)
Applications (42), (20), (19), (10), (10), (5), (2), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (4), (3), (2), (2), (2), (1), (1)
Beacon