Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183232

Zinc Finger Protein 79 (ZNF79) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms pT7
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183232
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF79 antibody: synthetic peptide directed towards the N terminal of human ZNF79
Sequence PSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSD LEKSFNLRPV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF79. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF79
Background ZNF79 mapped to 9q34 centromeric to the ABL gene and between a constitutional chromosomal translocation on the centromeric side and the CML specific ABL translocation on the telomeric side.
Molecular Weight 55kDa
Gene ID 7633
NCBI Accession NP_009066, NM_007135
UniProt Q15937
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF79 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Williams, Blacklow, Collins: "The zinc finger-associated SCAN box is a conserved oligomerization domain." in: Molecular and cellular biology, Vol. 19, Issue 12, pp. 8526-35, 2000 (PubMed).

Alternatives for antigen "Zinc Finger Protein 79 (ZNF79)", type "Antibodies"
Hosts (11), (3)
Reactivities (14)
Applications (12), (3), (2), (1), (1)
Epitopes (9), (2), (2), (1), (1)
Beacon