Zinc Finger Protein 79 (ZNF79) (N-Term) antibody

Details for Product No. ABIN183232
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms pT7
Epitope
N-Term
(6), (1), (1), (1)
Reactivity
Human
(12)
Host
Rabbit
(9), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183232
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF79
Sequence PSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSD LEKSFNLRPV
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF79. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ZNF79
Background ZNF79 mapped to 9q34 centromeric to the ABL gene and between a constitutional chromosomal translocation on the centromeric side and the CML specific ABL translocation on the telomeric side.
Molecular Weight 55 kDa
Gene ID 7633
NCBI Accession NM_007135, NP_009066
UniProt Q15937
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 498 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 79 (ZNF79) (N-Term) antibody WB Suggested Anti-ZNF79 Antibody Titration: 0.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Williams, Blacklow, Collins: "The zinc finger-associated SCAN box is a conserved oligomerization domain." in: Molecular and cellular biology, Vol. 19, Issue 12, pp. 8526-35, 2000 (PubMed).

Hosts (9), (3)
Reactivities (12)
Applications (10), (2), (2), (1), (1)
Epitopes (6), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top