Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183241

Zinc Finger and BTB Domain Containing 44 (ZBTB44) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTBD15, HSPC063, ZNF851, 6030404E16Rik, Btbd15, E230011F09, RGD1308984, btbd15, hspc063, MGC145247
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183241
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-BTBD15 antibody: synthetic peptide directed towards the C terminal of human BTBD15
Sequence PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPS ETGRRMADYV
Predicted Reactivity Human :100% Bovine :85%,   Rat :85%,   Dog :85%,   Mouse :85%,  
Characteristics This is a rabbit polyclonal antibody against BTBD15. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name BTBD15
Background Located on chromosome 11, the BTBD15 gene encodes a BTB (POZ) domain containing 15 protein with unknown function.
Molecular Weight 52kDa
Gene ID 29068
NCBI Accession NP_054874, NM_014155
UniProt Q86XX5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-BTBD15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 44 (ZBTB44)", type "Antibodies"
Hosts (21), (1)
Reactivities (21), (15), (13), (13), (13), (13), (12), (1)
Applications (13), (10), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (1), (1), (1), (1)
Beacon