Zinc Finger and BTB Domain Containing 44 (ZBTB44) (C-Term) antibody

Details for Product No. ABIN183241
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTBD15, HSPC063, ZNF851, 6030404E16Rik, Btbd15, E230011F09, RGD1308984, btbd15, hspc063, MGC145247
Epitope
C-Term
(9), (7), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(29), (15), (13), (13), (13), (13), (12), (1)
Host
Rabbit
(29), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (10), (9), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183241
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human BTBD15
Sequence PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPS ETGRRMADYV
Predicted Reactivity Human :100 % Bovine :80 %,   Rat :80 %,   Dog :80 %,   Mouse :80 %,  
Characteristics This is a rabbit polyclonal antibody against BTBD15. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name BTBD15
Background Located on chromosome 11, the BTBD15 gene encodes a BTB (POZ) domain containing 15 protein with unknown function.
Molecular Weight 52 kDa
Gene ID 29068
NCBI Accession NM_014155, NP_054874
UniProt Q86XX5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 467 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger and BTB Domain Containing 44 (ZBTB44) (C-Term) antibody WB Suggested Anti-BTBD15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (29), (1)
Reactivities (29), (15), (13), (13), (13), (13), (12), (1)
Applications (20), (10), (9), (3), (2), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (2), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top