Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183373

Gap Junction Protein, gamma 1, 45kDa (GJC1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GJA7, GJD3, CX45, GJC1, cx45, C130009G16Rik, Cnx45, Cx45, Gja-7, Gja7, gja7, MGC52735
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN183373
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the N terminal of human GJC1
Sequence IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAF PVSHYRFWLF
Predicted Reactivity Human :100%,   Bovine :100%,   Dog :100%,   Rat :100%,   Golden hamster :100%,   Chinese hamster :100%,   Mouse :100%,  
Characteristics This is a rabbit polyclonal antibody against GJC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name GJC1
Background CX31.9 is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells.
Molecular Weight 32kDa
Gene ID 125111
NCBI Accession NP_689343, NM_152219
UniProt Q6ZUW6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GJC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Terrier-Lacombe, Guillou, Maire et al.: "Dermatofibrosarcoma protuberans, giant cell fibroblastoma, and hybrid lesions in children: clinicopathologic comparative analysis of 28 cases with molecular data--a study from the French Federation of Cancer Centers Sarcoma Group." in: The American journal of surgical pathology, Vol. 27, Issue 1, pp. 27-39, 2002 (PubMed).

Background publications Söhl, Nielsen, Eiberger et al.: "Expression profiles of the novel human connexin genes hCx30.2, hCx40.1, and hCx62 differ from their putative mouse orthologues." in: Cell communication & adhesion, Vol. 10, Issue 1, pp. 27-36, 2003 (PubMed).

Alternatives for antigen "Gap Junction Protein, gamma 1, 45kDa (GJC1)", type "Antibodies"
Hosts (40), (3), (3)
Reactivities (44), (29), (28), (14), (14), (1), (1), (1)
Applications (37), (20), (10), (8), (7), (5), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (6), (5), (2), (2), (2), (1), (1)
Beacon