Distal-Less Homeobox 4 (DLX4) (N-Term) antibody

Details for Product No. ABIN183408
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BP1, DLX7, DLX8, DLX9, Dlx-4, Dlx7, DLX4
Epitope
N-Term
(9), (7), (6), (4), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(61), (21), (18), (16), (12), (1), (1)
Host
Rabbit
(57), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(52), (15), (13), (13), (10), (4), (4), (4), (3), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183408
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of mouse DLX4
Sequence YSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAE SEKLALSLVP
Predicted Reactivity Mouse : 100 %, Human : 90 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against DLX4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name DLX4
Background DLX4 is a member of the family of Dlx genes that are involved in early vertebrate morphogenesis, notably of the head.
Molecular Weight 26 kDa
Gene ID 13394
NCBI Accession NM_007867, NP_031893
UniProt P70436
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 240 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Distal-Less Homeobox 4 (DLX4) (N-Term) antibody WB Suggested Anti-DLX4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate
Background publications Kelly, Jerome-Majewska, Papaioannou: "The del22q11.2 candidate gene Tbx1 regulates branchiomeric myogenesis." in: Human molecular genetics, Vol. 13, Issue 22, pp. 2829-40, 2004 (PubMed).

Hosts (57), (8)
Reactivities (61), (21), (18), (16), (12), (1), (1)
Applications (52), (15), (13), (13), (10), (4), (4), (4), (3), (2), (2), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (6), (4), (3), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top