Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183408

Distal-Less Homeobox 4 (DLX4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BP1, DLX7, DLX8, DLX9, Dlx-4, Dlx7, DLX4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183408
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the N terminal of mouse DLX4
Sequence YSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAE SEKLALSLVP
Predicted Reactivity Mouse : 100%, Human : 91%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against DLX4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name DLX4
Background DLX4 is a member of the family of Dlx genes that are involved in early vertebrate morphogenesis, notably of the head.
Molecular Weight 26kDa
Gene ID 13394
NCBI Accession NP_031893, NM_007867
UniProt P70436
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DLX4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kelly, Jerome-Majewska, Papaioannou: "The del22q11.2 candidate gene Tbx1 regulates branchiomeric myogenesis." in: Human molecular genetics, Vol. 13, Issue 22, pp. 2829-40, 2004 (PubMed).

Alternatives for antigen "Distal-Less Homeobox 4 (DLX4)", type "Antibodies"
Hosts (58), (8), (1)
Reactivities (63), (22), (18), (16), (12), (1), (1)
Applications (53), (18), (16), (13), (10), (10), (4), (4), (3), (2), (1), (1)
Conjugates (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (6), (4), (3), (2), (2), (1), (1), (1)
Beacon