Myb-Binding Protein 1A (MYBBP1A) (C-Term) antibody

Details for Product No. ABIN183463
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P160, PAP2, p67MBP, p160MBP, AL024407, AU019902, DBP, cb486, sb:cb486, MYBBP1A, MGC98482, p160, pap2
Epitope
C-Term
(6), (3), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus)
(17), (5), (3)
Host
Rabbit
(18), (3)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(21), (6), (5), (4), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN183463
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of mouse MYBBP1A
Sequence DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGIT GAKSPAPSNP
Predicted Reactivity Mouse : 100 %
Characteristics This is a rabbit polyclonal antibody against MYBBP1A. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name MYBBP1A
Background Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Molecular Weight 148 kDa
Gene ID 18432
NCBI Accession NM_016776, NP_058056
UniProt Q7TPV4
Research Area Cancer, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1344 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Myb-Binding Protein 1A (MYBBP1A) (C-Term) antibody WB Suggested Anti-MYBBP1A Antibody Titration: 1.25ug/ml
Positive Control: SP2/0 cell lysate
anti-Myb-Binding Protein 1A (MYBBP1A) (C-Term) antibody (2) anti-Myb-Binding Protein 1A (MYBBP1A) (C-Term) antibody (Image 2)
anti-Myb-Binding Protein 1A (MYBBP1A) (C-Term) antibody (3) anti-Myb-Binding Protein 1A (MYBBP1A) (C-Term) antibody (Image 3)
Background publications Fan, Rhee, St-Pierre et al.: "Suppression of mitochondrial respiration through recruitment of p160 myb binding protein to PGC-1alpha: modulation by p38 MAPK." in: Genes & development, Vol. 18, Issue 3, pp. 278-89, 2004 (PubMed).

Hosts (18), (3)
Reactivities (17), (5), (3)
Applications (21), (6), (5), (4), (3), (2)
Epitopes (6), (3), (3), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top