Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183463

Myb-Binding Protein 1A (MYBBP1A) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P160, PAP2, p67MBP, p160MBP, AL024407, AU019902, DBP, cb486, sb:cb486, MYBBP1A, MGC98482, p160, pap2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183463
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MYBBP1A antibody: synthetic peptide directed towards the C terminal of mouse MYBBP1A
Sequence DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGIT GAKSPAPSNP
Predicted Reactivity Mouse : 100%
Characteristics This is a rabbit polyclonal antibody against MYBBP1A. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name MYBBP1A
Background Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Molecular Weight 148kDa
Gene ID 18432
NCBI Accession NP_058056, NM_016776
UniProt Q7TPV4
Research Area Cancer, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MYBBP1A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Fan, Rhee, St-Pierre et al.: "Suppression of mitochondrial respiration through recruitment of p160 myb binding protein to PGC-1alpha: modulation by p38 MAPK." in: Genes & development, Vol. 18, Issue 3, pp. 278-89, 2004 (PubMed).

Alternatives for antigen "Myb-Binding Protein 1A (MYBBP1A)", type "Antibodies"
Hosts (17), (2)
Reactivities (15), (6), (2)
Applications (19), (5), (4), (4), (3), (2), (1)
Epitopes (6), (2), (2), (2), (2), (1), (1), (1)
Beacon