Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183474

Iroquois Homeobox 6 (IRX6) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms IRX6, RGD1564830, IRX7, IRX-3, IRXB3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183474
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IRX6 antibody: synthetic peptide directed towards the C terminal of mouse IRX6
Sequence RAQSPECHMIPRQPSSIRRLLVPRDSEGEEDSPAAKAFGN STFTLQGLPL
Predicted Reactivity Mouse : 100%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against IRX6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name IRX6
Background IRX6 is one Iroquois (Irx) proteins comprise a family of homeodomain-containing transcription factors involved in patterning and regionalization of embryonic tissues in both vertebrates and invertebrates.
Molecular Weight 48kDa
Gene ID 64379
NCBI Accession NP_071873, NM_022428
UniProt Q8BFT1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IRX6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pan, Yang, Feng et al.: "Functional equivalence of Brn3 POU-domain transcription factors in mouse retinal neurogenesis." in: Development (Cambridge, England), Vol. 132, Issue 4, pp. 703-12, 2005 (PubMed).

Alternatives for antigen "Iroquois Homeobox 6 (IRX6)", type "Antibodies"
Hosts (16), (3)
Reactivities (17), (4), (2), (1), (1)
Applications (18), (5), (2), (1)
Epitopes (4), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon