Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183493

Forkhead Box P4 (FOXP4) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms hFKHLA, mFKHLA, 1200010K03Rik, 2310007G05Rik, FKHLA, foxp4a, foxp4b, FOXP4, hfkhla
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183493
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FOXP4 antibody: synthetic peptide corresponding to a region of Mouse
Sequence QEDLGVPGEPLPSNGSSSPPRLSPPQYSHQIQVKEEPAEA EEDRRPGPPL
Predicted Reactivity Mouse : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Human : 92%, Rabbit : 92%, Pig : 85%, Zebrafish : 84%, African clawed frog : 76%
Characteristics This is a rabbit polyclonal antibody against FOXP4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name FOXP4
Background Foxp4 is a member of the murine forkhead family of transcription factors. It is expressed exclusively in the epithelial cells of the developing intestine, where, in late development, it is expressed in a gradient along the longitudinal axis of the villi.
Molecular Weight 87kDa
Gene ID 74123
NCBI Accession NP_083043, NM_028767
UniProt Q9DBY0
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FOXP4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Li, Zhou, Lu et al.: "Advanced cardiac morphogenesis does not require heart tube fusion." in: Science (New York, N.Y.), Vol. 305, Issue 5690, pp. 1619-22, 2004 (PubMed).

Alternatives for antigen "Forkhead Box P4 (FOXP4)", type "Antibodies"
Hosts (30), (7), (2), (1)
Reactivities (35), (11), (8), (5), (2), (1)
Applications (26), (12), (11), (6), (2), (1), (1)
Epitopes (10), (5), (2), (2), (1), (1), (1), (1), (1)
Beacon