Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183500

SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 1 (SMARCA1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SNF2LT, SWI, SWI2, Snf2l, 5730494M04Rik, RGD1561046, snf2l, MGC80667, SMARCA1, DKFZp459M1930
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus)
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183500
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SMARCA1 antibody: synthetic peptide directed towards the N terminal of mouse SMARCA1
Sequence VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATE KGEKKEKITS
Predicted Reactivity Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against SMARCA1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SMARCA1
Background CDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN.
Molecular Weight 43kDa
Gene ID 93761
NCBI Accession BAC28931, NM_053123
UniProt Q8BS67
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SMARCA1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Okazaki, Furuno, Kasukawa et al.: "Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs." in: Nature, Vol. 420, Issue 6915, pp. 563-73, 2002 (PubMed).

Alternatives for antigen "SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A, Member 1 (SMARCA1)", type "Antibodies"
Hosts (23)
Reactivities (22), (15), (15), (14), (12), (12), (3)
Applications (12), (10), (4), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (1), (1)
Beacon