Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183531

Reproductive Homeobox 11 (Rhox11) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC049711, Gm39
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183531
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RHOX11 antibody: synthetic peptide directed towards the N terminal of mouse RHOX11
Sequence VMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPG QLWELQAVFV
Predicted Reactivity Mouse : 100%
Characteristics This is a rabbit polyclonal antibody against RHOX11. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RHOX11
Background Homeobox proteins are transcription factors notable for their ability to regulate embryogenesis. The reproductive homeobox proteins (Rhox) are expressed in a cell type-specific manner, several are hormonally regulated, and their expression pattern during postnatal testis development corresponds to their chromosomal position. Most of the Rhox proteins are expressed in Sertoli cells, the nurse cells in direct contact with developing male germ cells, suggesting that they regulate the expression of somatic-cell gene products critical for germ cell development.
Molecular Weight 23kDa
Gene ID 194738
NCBI Accession NP_941000, NM_198598
UniProt Q810N8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RHOX11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Maclean, Chen, Wayne et al.: "Rhox: a new homeobox gene cluster." in: Cell, Vol. 120, Issue 3, pp. 369-82, 2005 (PubMed).

Alternatives for antigen "Reproductive Homeobox 11 (Rhox11)", type "Antibodies"
Hosts (4)
Reactivities (4)
Applications (4), (2)
Epitopes (2), (1)
Beacon