Reproductive Homeobox 11 (Rhox11) (N-Term) antibody

Details for Product No. ABIN183531
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC049711, Gm39
Epitope
N-Term
(1), (1)
Reactivity
Mouse (Murine)
(3)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1)
Pubmed 1 reference available
Catalog no. ABIN183531
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of mouse RHOX11
Sequence VMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPG QLWELQAVFV
Predicted Reactivity Mouse : 100 %
Characteristics This is a rabbit polyclonal antibody against RHOX11. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RHOX11
Background Homeobox proteins are transcription factors notable for their ability to regulate embryogenesis. The reproductive homeobox proteins (Rhox) are expressed in a cell type-specific manner, several are hormonally regulated, and their expression pattern during postnatal testis development corresponds to their chromosomal position. Most of the Rhox proteins are expressed in Sertoli cells, the nurse cells in direct contact with developing male germ cells, suggesting that they regulate the expression of somatic-cell gene products critical for germ cell development.
Molecular Weight 23 kDa
Gene ID 194738
NCBI Accession NM_198598, NP_941000
UniProt Q810N8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 206 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Reproductive Homeobox 11 (Rhox11) (N-Term) antibody WB Suggested Anti-RHOX11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
Background publications Maclean, Chen, Wayne et al.: "Rhox: a new homeobox gene cluster." in: Cell, Vol. 120, Issue 3, pp. 369-82, 2005 (PubMed).

Hosts (3)
Reactivities (3)
Applications (3), (1)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top