Did you know that you can buy products from over 140 different suppliers from us?

POU Domain, Class 2, Transcription Factor 1 (POU2F1) (C-Term) antibody

Details for Product No. ABIN183532
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OCT1, OTF1, oct-1B, 2810482H01Rik, NF-A1, Oct-1, Oct1, Otf-1, Otf1, chOCT-1, POU2F1
Epitope
C-Term
(13), (10), (9), (8), (7), (4), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine)
(78), (27), (24), (2), (2), (1), (1)
Host
Rabbit
(66), (12), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(74), (33), (21), (17), (10), (5), (4), (3), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183532
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of mouse POU2F1
Sequence VTSSTATTLTVNPVLPLTSAAVTNLSLTGKQQPAYRLVST VPVRFLWRTA
Predicted Reactivity Mouse (Murine)
Characteristics This is a rabbit polyclonal antibody against POU2F1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name POU2F1
Background POU2F1 is a member of the POU family that represents the double-stranded DNA binding proteins specifically binding to the block C region.
Molecular Weight 57 kDa
Gene ID 18986
NCBI Accession NM_198932, NP_945150
UniProt P25425-10
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 522 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-POU Domain, Class 2, Transcription Factor 1 (POU2F1) (C-Term) antibody WB Suggested Anti-POU2F1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: SP2/0 cell lysate
Product cited in: Tantin, Schild-Poulter, Wang et al.: "The octamer binding transcription factor Oct-1 is a stress sensor." in: Cancer research, Vol. 65, Issue 23, pp. 10750-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183532
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top