Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183532

POU Domain, Class 2, Transcription Factor 1 (POU2F1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OCT1, OTF1, oct-1B, 2810482H01Rik, NF-A1, Oct-1, Oct1, Otf-1, Otf1, chOCT-1, POU2F1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183532
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-POU2F1 antibody: synthetic peptide directed towards the C terminal of mouse POU2F1
Sequence VTSSTATTLTVNPVLPLTSAAVTNLSLTGKQQPAYRLVST VPVRFLWRTA
Characteristics This is a rabbit polyclonal antibody against POU2F1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name POU2F1
Background POU2F1 is a member of the POU family that represents the double-stranded DNA binding proteins specifically binding to the block C region.
Molecular Weight 57kDa
Gene ID 18986
NCBI Accession NP_945150, NM_198932
UniProt P25425-10
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-POU2F1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Tantin, Schild-Poulter, Wang et al.: "The octamer binding transcription factor Oct-1 is a stress sensor." in: Cancer research, Vol. 65, Issue 23, pp. 10750-8, 2005 (PubMed).

Alternatives for antigen "POU Domain, Class 2, Transcription Factor 1 (POU2F1)", type "Antibodies"
Hosts (53), (11), (3)
Reactivities (64), (31), (26), (3), (2), (2), (2), (1), (1)
Applications (61), (21), (17), (15), (12), (3), (3), (3), (2), (1), (1), (1), (1)
Epitopes (8), (7), (5), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon